Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q4U136

Protein Details
Accession A0A4Q4U136    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
127-152YGGATPTKKRQRRTPAPKKRATVFKSHydrophilic
NLS Segment(s)
PositionSequence
80-106PKAKAGPKKGVSSAPAKGIGTSGRKRT
134-147KKRQRRTPAPKKRA
Subcellular Location(s) cyto 14, cyto_nucl 12.5, nucl 9, mito 3
Family & Domain DBs
Amino Acid Sequences MADSNNTNEGAGGKWTDAEKASLMVQIIDQLTSAGGKVRLGELNMPGRTPKSLMHMLGKIKDEAAAHKVEGGSGSVPATPKAKAGPKKGVSSAPAKGIGTSGRKRTKTAAAATGSDAGDDGEKDDDYGGATPTKKRQRRTPAPKKRATVFKSEAKAEDTVSEDGEDENKPDTAAVEAADVVNAAISAANSAAALDGVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.15
4 0.15
5 0.15
6 0.14
7 0.14
8 0.15
9 0.14
10 0.14
11 0.12
12 0.11
13 0.13
14 0.12
15 0.11
16 0.1
17 0.08
18 0.08
19 0.08
20 0.08
21 0.08
22 0.08
23 0.08
24 0.09
25 0.11
26 0.13
27 0.14
28 0.16
29 0.18
30 0.24
31 0.24
32 0.24
33 0.23
34 0.23
35 0.23
36 0.22
37 0.19
38 0.18
39 0.22
40 0.24
41 0.27
42 0.3
43 0.32
44 0.35
45 0.35
46 0.29
47 0.24
48 0.24
49 0.2
50 0.18
51 0.18
52 0.15
53 0.13
54 0.14
55 0.14
56 0.12
57 0.12
58 0.1
59 0.07
60 0.07
61 0.07
62 0.07
63 0.07
64 0.08
65 0.09
66 0.09
67 0.09
68 0.13
69 0.2
70 0.25
71 0.3
72 0.38
73 0.41
74 0.43
75 0.45
76 0.43
77 0.39
78 0.36
79 0.32
80 0.25
81 0.23
82 0.2
83 0.18
84 0.16
85 0.17
86 0.19
87 0.2
88 0.26
89 0.32
90 0.33
91 0.34
92 0.37
93 0.4
94 0.39
95 0.39
96 0.36
97 0.31
98 0.31
99 0.31
100 0.3
101 0.23
102 0.18
103 0.15
104 0.09
105 0.08
106 0.07
107 0.07
108 0.05
109 0.05
110 0.05
111 0.05
112 0.05
113 0.06
114 0.06
115 0.07
116 0.08
117 0.1
118 0.13
119 0.22
120 0.32
121 0.37
122 0.42
123 0.51
124 0.6
125 0.7
126 0.79
127 0.82
128 0.83
129 0.88
130 0.9
131 0.85
132 0.82
133 0.8
134 0.72
135 0.7
136 0.65
137 0.62
138 0.59
139 0.56
140 0.5
141 0.43
142 0.4
143 0.31
144 0.27
145 0.22
146 0.19
147 0.17
148 0.15
149 0.13
150 0.13
151 0.14
152 0.13
153 0.1
154 0.11
155 0.11
156 0.11
157 0.1
158 0.1
159 0.1
160 0.1
161 0.09
162 0.08
163 0.08
164 0.08
165 0.08
166 0.07
167 0.06
168 0.05
169 0.04
170 0.04
171 0.04
172 0.04
173 0.04
174 0.04
175 0.05
176 0.05
177 0.05
178 0.05