Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q4U283

Protein Details
Accession A0A4Q4U283    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
35-60FLAKMKWRQNAKKNQKTKKSQPGGCQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 10, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036770  Ankyrin_rpt-contain_sf  
Amino Acid Sequences MLVLRWGADPLARDRAGRTAEGYARENGDRETASFLAKMKWRQNAKKNQKTKKSQPGGCQASVAQDSIGRYGNDSTRKLT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.29
3 0.29
4 0.27
5 0.25
6 0.22
7 0.24
8 0.28
9 0.28
10 0.24
11 0.24
12 0.24
13 0.23
14 0.19
15 0.18
16 0.14
17 0.13
18 0.15
19 0.13
20 0.13
21 0.13
22 0.13
23 0.14
24 0.17
25 0.22
26 0.23
27 0.3
28 0.37
29 0.45
30 0.53
31 0.61
32 0.69
33 0.74
34 0.79
35 0.82
36 0.84
37 0.86
38 0.87
39 0.86
40 0.85
41 0.81
42 0.78
43 0.79
44 0.75
45 0.66
46 0.57
47 0.46
48 0.4
49 0.36
50 0.28
51 0.18
52 0.14
53 0.14
54 0.15
55 0.18
56 0.14
57 0.15
58 0.18
59 0.24
60 0.29