Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q4VY76

Protein Details
Accession A0A4Q4VY76    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
5-26NREGGKVKPLKQAKKQQKDLDEHydrophilic
NLS Segment(s)
PositionSequence
34-69KKKAEEKARAELAKKIGGGKGPLNTGSQGIKKSGKK
Subcellular Location(s) mito 14, nucl 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR015157  TMA7  
Pfam View protein in Pfam  
PF09072  TMA7  
Amino Acid Sequences MGGANREGGKVKPLKQAKKQQKDLDEDDKAYLEKKKAEEKARAELAKKIGGGKGPLNTGSQGIKKSGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.62
3 0.72
4 0.75
5 0.8
6 0.84
7 0.82
8 0.8
9 0.77
10 0.74
11 0.71
12 0.62
13 0.53
14 0.44
15 0.37
16 0.31
17 0.26
18 0.22
19 0.16
20 0.16
21 0.18
22 0.24
23 0.3
24 0.36
25 0.42
26 0.42
27 0.47
28 0.5
29 0.5
30 0.44
31 0.42
32 0.39
33 0.34
34 0.31
35 0.26
36 0.22
37 0.22
38 0.23
39 0.22
40 0.22
41 0.21
42 0.22
43 0.22
44 0.21
45 0.21
46 0.23
47 0.23
48 0.23
49 0.26