Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4V1XLV4

Protein Details
Accession A0A4V1XLV4   
Localization Confidence Medium
Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
44-73ATPSTKKGESKTKKKRHHKDRAEHELRKFDBasic
NLS Segment(s)
PositionSequence
49-65KKGESKTKKKRHHKDRA
Subcellular Location(s) nucl 22, cyto_nucl 14, cyto 4
Family & Domain DBs
Amino Acid Sequences MPSPSDNPHHQTAGTSSGKDDPPSYALQEYLRADPTVTERCSGATPSTKKGESKTKKKRHHKDRAEHELRKFDDAWRDAATK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.25
3 0.22
4 0.26
5 0.27
6 0.26
7 0.24
8 0.18
9 0.19
10 0.2
11 0.2
12 0.16
13 0.16
14 0.15
15 0.19
16 0.19
17 0.18
18 0.18
19 0.16
20 0.15
21 0.14
22 0.18
23 0.19
24 0.18
25 0.17
26 0.15
27 0.16
28 0.17
29 0.17
30 0.15
31 0.17
32 0.19
33 0.22
34 0.26
35 0.27
36 0.27
37 0.31
38 0.4
39 0.43
40 0.52
41 0.59
42 0.66
43 0.76
44 0.85
45 0.92
46 0.92
47 0.94
48 0.93
49 0.92
50 0.92
51 0.93
52 0.92
53 0.88
54 0.82
55 0.79
56 0.71
57 0.64
58 0.54
59 0.47
60 0.47
61 0.42
62 0.4