Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4V1XHV8

Protein Details
Accession A0A4V1XHV8   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
10-37QPNGAPRSQNRQPRRGRSSRSRGGRSRGHydrophilic
NLS Segment(s)
PositionSequence
19-43NRQPRRGRSSRSRGGRSRGEHRRGG
76-93RGGRGPSGRRGARHPRGN
Subcellular Location(s) nucl 16.5, cyto_nucl 9.333, mito 8.5, cyto_mito 5.333
Family & Domain DBs
Amino Acid Sequences MADSQGASVQPNGAPRSQNRQPRRGRSSRSRGGRSRGEHRRGGGSHSTGVAATAGEATTANIASDNAAAATNESARGGRGPSGRRGARHPRGNHDRGHRTTFGTQRPFGGRLTEEPNLAGVESGALNADAPVFVPGQPVTAERKSVQDEQGGPRNHVRRRSKSTAPDLPTRIHEDISNGQYECGICTNEVLRNSKVCLTSIREAGGVLAATRQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.29
3 0.38
4 0.44
5 0.53
6 0.56
7 0.64
8 0.71
9 0.76
10 0.82
11 0.82
12 0.84
13 0.85
14 0.86
15 0.86
16 0.86
17 0.85
18 0.82
19 0.8
20 0.79
21 0.74
22 0.75
23 0.75
24 0.72
25 0.67
26 0.62
27 0.62
28 0.54
29 0.54
30 0.49
31 0.41
32 0.36
33 0.32
34 0.3
35 0.22
36 0.21
37 0.15
38 0.09
39 0.07
40 0.05
41 0.05
42 0.04
43 0.05
44 0.04
45 0.05
46 0.05
47 0.05
48 0.05
49 0.05
50 0.05
51 0.05
52 0.05
53 0.05
54 0.05
55 0.05
56 0.05
57 0.06
58 0.06
59 0.06
60 0.06
61 0.06
62 0.06
63 0.07
64 0.07
65 0.11
66 0.15
67 0.18
68 0.23
69 0.3
70 0.32
71 0.33
72 0.4
73 0.47
74 0.51
75 0.56
76 0.54
77 0.56
78 0.64
79 0.65
80 0.63
81 0.61
82 0.61
83 0.56
84 0.58
85 0.49
86 0.43
87 0.44
88 0.45
89 0.43
90 0.38
91 0.35
92 0.33
93 0.33
94 0.32
95 0.27
96 0.23
97 0.17
98 0.16
99 0.2
100 0.19
101 0.17
102 0.15
103 0.16
104 0.14
105 0.13
106 0.1
107 0.05
108 0.04
109 0.04
110 0.04
111 0.03
112 0.03
113 0.03
114 0.03
115 0.03
116 0.03
117 0.03
118 0.04
119 0.05
120 0.05
121 0.06
122 0.06
123 0.07
124 0.08
125 0.09
126 0.14
127 0.14
128 0.16
129 0.16
130 0.2
131 0.23
132 0.27
133 0.27
134 0.26
135 0.28
136 0.31
137 0.38
138 0.36
139 0.34
140 0.38
141 0.43
142 0.44
143 0.5
144 0.54
145 0.55
146 0.64
147 0.69
148 0.7
149 0.72
150 0.76
151 0.75
152 0.71
153 0.69
154 0.63
155 0.58
156 0.53
157 0.51
158 0.43
159 0.35
160 0.31
161 0.28
162 0.31
163 0.31
164 0.31
165 0.24
166 0.23
167 0.23
168 0.23
169 0.2
170 0.16
171 0.14
172 0.11
173 0.12
174 0.15
175 0.18
176 0.23
177 0.26
178 0.26
179 0.27
180 0.3
181 0.33
182 0.32
183 0.29
184 0.29
185 0.32
186 0.35
187 0.35
188 0.34
189 0.29
190 0.28
191 0.27
192 0.23
193 0.16