Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2L596

Protein Details
Accession E2L596   
Localization Confidence Medium
Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
89-119YRIHGVYRPRRNRSGRLQKAKFTNRKRSSTLHydrophilic
NLS Segment(s)
PositionSequence
99-116PRRNRSGRLQKAKFTNRK
Subcellular Location(s) nucl 21, cyto_nucl 13.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR042035  DEAH_win-hel_dom  
IPR007502  Helicase-assoc_dom  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0004386  F:helicase activity  
KEGG mpr:MPER_00925  -  
Pfam View protein in Pfam  
PF04408  HA2  
Amino Acid Sequences AEAALRNEMLPNSIPDIQRTNLSTTILQLKAMGINDLLSFDFMDPPPAQTMLTALESLYALSALDDEXLLTRLGRKMADFPMEPXVSEDAYRIHGVYRPRRNRSGRLQKAKFTNRKRSSTL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.24
3 0.27
4 0.26
5 0.29
6 0.29
7 0.28
8 0.25
9 0.27
10 0.24
11 0.22
12 0.28
13 0.24
14 0.22
15 0.18
16 0.17
17 0.17
18 0.17
19 0.15
20 0.08
21 0.09
22 0.08
23 0.09
24 0.08
25 0.06
26 0.06
27 0.06
28 0.08
29 0.07
30 0.11
31 0.1
32 0.11
33 0.12
34 0.12
35 0.11
36 0.09
37 0.1
38 0.08
39 0.09
40 0.08
41 0.07
42 0.07
43 0.06
44 0.06
45 0.05
46 0.04
47 0.03
48 0.03
49 0.03
50 0.02
51 0.03
52 0.03
53 0.03
54 0.03
55 0.04
56 0.04
57 0.05
58 0.06
59 0.07
60 0.08
61 0.08
62 0.11
63 0.13
64 0.17
65 0.17
66 0.19
67 0.22
68 0.22
69 0.22
70 0.19
71 0.19
72 0.16
73 0.16
74 0.15
75 0.13
76 0.13
77 0.13
78 0.13
79 0.14
80 0.22
81 0.31
82 0.41
83 0.48
84 0.55
85 0.64
86 0.7
87 0.75
88 0.79
89 0.8
90 0.8
91 0.82
92 0.81
93 0.79
94 0.83
95 0.85
96 0.84
97 0.83
98 0.83
99 0.81