Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q4UFZ1

Protein Details
Accession A0A4Q4UFZ1    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
110-135RQRNRLAASKCRRKSKQKNEIMLEREHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000837  AP-1  
IPR004827  bZIP  
IPR046347  bZIP_sf  
IPR002112  Leuzip_Jun  
Gene Ontology GO:0003677  F:DNA binding  
GO:0003700  F:DNA-binding transcription factor activity  
GO:0006357  P:regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF07716  bZIP_2  
PROSITE View protein in PROSITE  
PS50217  BZIP  
PS00036  BZIP_BASIC  
CDD cd14687  bZIP_ATF2  
Amino Acid Sequences MRRSTFEYREPLPLPVLIGPLDGSPGQSSDDDLYSFHTSPMLKRDDICINVDPRELDQSESLLPAQRQSNRVVGAQTETPPPESVRDLRPPRKRRHTETSDTDSQAELRRQRNRLAASKCRRKSKQKNEIMLERERELEQQYHLLKSCVQSLKVEVLDLREELLKHAHCDCEPIQNHIAKTAQAVMSQPNIAAPWQASSPQLGEGC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.24
3 0.23
4 0.16
5 0.14
6 0.13
7 0.11
8 0.12
9 0.1
10 0.1
11 0.09
12 0.1
13 0.11
14 0.11
15 0.13
16 0.12
17 0.13
18 0.13
19 0.12
20 0.16
21 0.18
22 0.19
23 0.17
24 0.18
25 0.18
26 0.2
27 0.27
28 0.26
29 0.23
30 0.23
31 0.28
32 0.3
33 0.32
34 0.33
35 0.31
36 0.29
37 0.29
38 0.3
39 0.25
40 0.21
41 0.23
42 0.2
43 0.17
44 0.15
45 0.16
46 0.15
47 0.15
48 0.14
49 0.13
50 0.12
51 0.14
52 0.19
53 0.21
54 0.23
55 0.24
56 0.28
57 0.26
58 0.27
59 0.25
60 0.21
61 0.19
62 0.19
63 0.18
64 0.16
65 0.15
66 0.15
67 0.16
68 0.16
69 0.15
70 0.16
71 0.17
72 0.19
73 0.28
74 0.35
75 0.43
76 0.53
77 0.6
78 0.67
79 0.75
80 0.78
81 0.76
82 0.78
83 0.77
84 0.74
85 0.73
86 0.71
87 0.64
88 0.57
89 0.5
90 0.4
91 0.33
92 0.29
93 0.25
94 0.24
95 0.26
96 0.32
97 0.33
98 0.37
99 0.42
100 0.43
101 0.48
102 0.49
103 0.53
104 0.57
105 0.65
106 0.68
107 0.72
108 0.74
109 0.77
110 0.81
111 0.82
112 0.83
113 0.82
114 0.84
115 0.81
116 0.8
117 0.74
118 0.68
119 0.59
120 0.49
121 0.42
122 0.33
123 0.29
124 0.24
125 0.21
126 0.17
127 0.2
128 0.21
129 0.21
130 0.21
131 0.2
132 0.2
133 0.19
134 0.26
135 0.23
136 0.22
137 0.21
138 0.23
139 0.27
140 0.25
141 0.24
142 0.17
143 0.16
144 0.17
145 0.16
146 0.15
147 0.12
148 0.12
149 0.13
150 0.18
151 0.16
152 0.18
153 0.2
154 0.22
155 0.2
156 0.25
157 0.25
158 0.29
159 0.29
160 0.33
161 0.36
162 0.38
163 0.38
164 0.36
165 0.36
166 0.27
167 0.27
168 0.26
169 0.22
170 0.19
171 0.2
172 0.19
173 0.21
174 0.21
175 0.19
176 0.15
177 0.14
178 0.14
179 0.14
180 0.12
181 0.12
182 0.13
183 0.14
184 0.14
185 0.15
186 0.16