Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4V4J6

Protein Details
Accession A0A4Q4V4J6   
Localization Confidence High
Confidence Score 17.4
NoLS Segment(s)
PositionSequenceProtein Nature
73-98EIARLKKEYEEKQRKKKEKEAEKDKGBasic
102-127EKEKDKKDEKEKDKKDEKKDEPKPGEAcidic
NLS Segment(s)
PositionSequence
66-69KKRE
73-135EIARLKKEYEEKQRKKKEKEAEKDKGKDGEKEKDKKDEKEKDKKDEKKDEPKPGETGKKQEAG
Subcellular Location(s) nucl 21.5, cyto_nucl 13.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013640  Vfa1  
Pfam View protein in Pfam  
PF08432  Vfa1  
Amino Acid Sequences MSFPNVWHHRKVAETAAKACEICYRPSSSVLITPDNKDWFYVCPMHLKDTKFCTPIIDHEAIAARKKREEDEEIARLKKEYEEKQRKKKEKEAEKDKGKDGEKEKDKKDEKEKDKKDEKKDEPKPGETGKKQEAGAPPKDEEPKVFALQKTFYQQRLNKKRQAEMAKKMRERMKEPDFFPAVPKGDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.43
3 0.43
4 0.42
5 0.39
6 0.36
7 0.34
8 0.28
9 0.28
10 0.28
11 0.3
12 0.29
13 0.32
14 0.33
15 0.27
16 0.3
17 0.29
18 0.32
19 0.3
20 0.31
21 0.34
22 0.35
23 0.33
24 0.29
25 0.27
26 0.22
27 0.24
28 0.24
29 0.2
30 0.25
31 0.26
32 0.31
33 0.34
34 0.35
35 0.35
36 0.39
37 0.43
38 0.37
39 0.35
40 0.33
41 0.3
42 0.31
43 0.33
44 0.27
45 0.22
46 0.22
47 0.26
48 0.24
49 0.27
50 0.27
51 0.22
52 0.24
53 0.25
54 0.26
55 0.27
56 0.31
57 0.31
58 0.33
59 0.38
60 0.39
61 0.39
62 0.37
63 0.32
64 0.27
65 0.26
66 0.26
67 0.27
68 0.35
69 0.45
70 0.54
71 0.65
72 0.75
73 0.8
74 0.8
75 0.81
76 0.8
77 0.79
78 0.8
79 0.8
80 0.79
81 0.79
82 0.75
83 0.69
84 0.66
85 0.56
86 0.52
87 0.46
88 0.46
89 0.47
90 0.5
91 0.5
92 0.54
93 0.57
94 0.58
95 0.63
96 0.64
97 0.65
98 0.69
99 0.73
100 0.73
101 0.79
102 0.81
103 0.8
104 0.81
105 0.8
106 0.8
107 0.82
108 0.82
109 0.78
110 0.72
111 0.67
112 0.63
113 0.63
114 0.56
115 0.54
116 0.48
117 0.46
118 0.44
119 0.44
120 0.45
121 0.42
122 0.44
123 0.41
124 0.38
125 0.39
126 0.42
127 0.38
128 0.32
129 0.3
130 0.29
131 0.29
132 0.32
133 0.28
134 0.28
135 0.29
136 0.31
137 0.35
138 0.35
139 0.35
140 0.4
141 0.45
142 0.53
143 0.61
144 0.67
145 0.66
146 0.67
147 0.69
148 0.7
149 0.75
150 0.73
151 0.72
152 0.74
153 0.77
154 0.76
155 0.77
156 0.75
157 0.71
158 0.68
159 0.67
160 0.66
161 0.64
162 0.61
163 0.63
164 0.6
165 0.53
166 0.51
167 0.48