Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4VVT0

Protein Details
Accession A0A4Q4VVT0   
Localization Confidence Medium
Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
9-31TSPSLPARPKHPRRGSSKAPSLSHydrophilic
NLS Segment(s)
PositionSequence
20-21PR
Subcellular Location(s) mito 16, nucl 7.5, cyto_nucl 6, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006931  Calcipressin  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0019722  P:calcium-mediated signaling  
Pfam View protein in Pfam  
PF04847  Calcipressin  
CDD cd12434  RRM_RCAN_like  
Amino Acid Sequences MSETSSTPTSPSLPARPKHPRRGSSKAPSLSLDLSNLPPLVQPTPPTNTLLFTNLNDLDIFRPENLQAIRDLISQTAPVATWAPLKSFRRIVVSFPDEQAAIRVRSIWDGEAIMGERCRVYFGQHTPLSNHPGGRNDPKHHLELPDAGKLFFISPPPSPPHGWEMRLEDAPNKQVHAEDLADALAKLRHHQDPASAISGDMPSPVSPATTAAGDGAGGQQQQTRATRSRSSTLIYMPQEHGGSPMLPAISVDDMTDEPAEISPFPAEKPIPAHTARPPVELMTE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.51
3 0.6
4 0.68
5 0.74
6 0.79
7 0.78
8 0.78
9 0.84
10 0.85
11 0.84
12 0.84
13 0.77
14 0.7
15 0.63
16 0.58
17 0.51
18 0.42
19 0.34
20 0.27
21 0.23
22 0.23
23 0.21
24 0.17
25 0.15
26 0.16
27 0.16
28 0.16
29 0.17
30 0.19
31 0.24
32 0.26
33 0.28
34 0.26
35 0.25
36 0.25
37 0.26
38 0.24
39 0.19
40 0.23
41 0.2
42 0.2
43 0.18
44 0.17
45 0.15
46 0.15
47 0.16
48 0.11
49 0.13
50 0.12
51 0.17
52 0.17
53 0.16
54 0.15
55 0.15
56 0.16
57 0.16
58 0.17
59 0.12
60 0.12
61 0.11
62 0.1
63 0.09
64 0.07
65 0.07
66 0.08
67 0.08
68 0.12
69 0.12
70 0.14
71 0.21
72 0.24
73 0.27
74 0.3
75 0.31
76 0.33
77 0.34
78 0.34
79 0.35
80 0.36
81 0.33
82 0.3
83 0.29
84 0.22
85 0.22
86 0.21
87 0.16
88 0.13
89 0.11
90 0.11
91 0.11
92 0.12
93 0.13
94 0.11
95 0.09
96 0.08
97 0.08
98 0.08
99 0.08
100 0.08
101 0.07
102 0.07
103 0.06
104 0.06
105 0.08
106 0.07
107 0.09
108 0.14
109 0.17
110 0.24
111 0.26
112 0.27
113 0.28
114 0.3
115 0.33
116 0.29
117 0.28
118 0.21
119 0.23
120 0.25
121 0.31
122 0.34
123 0.32
124 0.37
125 0.38
126 0.39
127 0.37
128 0.35
129 0.28
130 0.28
131 0.27
132 0.24
133 0.22
134 0.19
135 0.17
136 0.16
137 0.16
138 0.11
139 0.1
140 0.09
141 0.09
142 0.13
143 0.16
144 0.19
145 0.19
146 0.2
147 0.24
148 0.25
149 0.26
150 0.25
151 0.26
152 0.26
153 0.26
154 0.25
155 0.22
156 0.21
157 0.23
158 0.21
159 0.18
160 0.15
161 0.14
162 0.15
163 0.14
164 0.13
165 0.09
166 0.09
167 0.09
168 0.08
169 0.08
170 0.08
171 0.08
172 0.07
173 0.09
174 0.12
175 0.15
176 0.16
177 0.17
178 0.19
179 0.2
180 0.23
181 0.24
182 0.2
183 0.17
184 0.17
185 0.17
186 0.15
187 0.11
188 0.09
189 0.06
190 0.07
191 0.07
192 0.06
193 0.06
194 0.07
195 0.08
196 0.07
197 0.08
198 0.07
199 0.07
200 0.06
201 0.06
202 0.06
203 0.06
204 0.06
205 0.06
206 0.08
207 0.1
208 0.14
209 0.16
210 0.21
211 0.25
212 0.3
213 0.35
214 0.38
215 0.41
216 0.39
217 0.4
218 0.37
219 0.36
220 0.38
221 0.35
222 0.34
223 0.31
224 0.32
225 0.29
226 0.27
227 0.25
228 0.19
229 0.17
230 0.13
231 0.13
232 0.1
233 0.1
234 0.1
235 0.1
236 0.1
237 0.1
238 0.09
239 0.09
240 0.1
241 0.11
242 0.12
243 0.09
244 0.09
245 0.1
246 0.11
247 0.09
248 0.1
249 0.11
250 0.12
251 0.12
252 0.16
253 0.16
254 0.18
255 0.22
256 0.25
257 0.29
258 0.3
259 0.35
260 0.37
261 0.46
262 0.45
263 0.44
264 0.41