Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q4VHT2

Protein Details
Accession A0A4Q4VHT2    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
161-185AESTNDKRGKRKERQQPKIRPHPGGBasic
NLS Segment(s)
PositionSequence
167-181KRGKRKERQQPKIRP
Subcellular Location(s) nucl 14, cyto_nucl 13.5, cyto 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR029001  ITPase-like_fam  
IPR003697  Maf-like  
Gene Ontology GO:0047429  F:nucleoside triphosphate diphosphatase activity  
Pfam View protein in Pfam  
PF02545  Maf  
CDD cd00555  Maf  
Amino Acid Sequences MDEKKPLIPSSDDNNNNHNTPADPPPSYVASAREHGIPLRQSGTPPIRKGGPPSPPQPLELPIIQYMRSHRVILASASPRRRAMLAQLGLGNIEVRPSTKPEDLSKAELGPHGYVAATARQKALDVYQAAIAELQGAEAGAGDGDEQEGDDAAEQGEGGGAESTNDKRGKRKERQQPKIRPHPGGDPDLVIAADTVIVTRDGQVLEKPTSEAAHVRMLRHLRDTRVHRVLTAVCAVAPRADAAHPGYEMRTHVEETRVWFAREGDGLPDDVLERYVRTREGADKAGGYAVQGVGGMLLVEKVDGAVDNVVGLPVRRCLQLCEKVVFRQDEESDEESGEEEGGSGGW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.52
3 0.49
4 0.45
5 0.39
6 0.3
7 0.28
8 0.33
9 0.32
10 0.29
11 0.3
12 0.32
13 0.33
14 0.34
15 0.31
16 0.27
17 0.26
18 0.27
19 0.27
20 0.25
21 0.24
22 0.24
23 0.28
24 0.25
25 0.24
26 0.25
27 0.24
28 0.24
29 0.31
30 0.39
31 0.41
32 0.41
33 0.42
34 0.44
35 0.45
36 0.51
37 0.5
38 0.49
39 0.49
40 0.52
41 0.57
42 0.53
43 0.54
44 0.49
45 0.44
46 0.39
47 0.33
48 0.31
49 0.26
50 0.26
51 0.24
52 0.24
53 0.25
54 0.27
55 0.27
56 0.25
57 0.22
58 0.23
59 0.23
60 0.23
61 0.26
62 0.27
63 0.32
64 0.35
65 0.38
66 0.37
67 0.37
68 0.36
69 0.3
70 0.29
71 0.32
72 0.29
73 0.29
74 0.28
75 0.27
76 0.26
77 0.25
78 0.19
79 0.09
80 0.08
81 0.06
82 0.06
83 0.08
84 0.11
85 0.16
86 0.18
87 0.21
88 0.24
89 0.31
90 0.33
91 0.36
92 0.34
93 0.3
94 0.29
95 0.27
96 0.25
97 0.18
98 0.15
99 0.11
100 0.1
101 0.09
102 0.09
103 0.13
104 0.13
105 0.13
106 0.14
107 0.14
108 0.14
109 0.14
110 0.14
111 0.13
112 0.12
113 0.12
114 0.13
115 0.13
116 0.13
117 0.12
118 0.11
119 0.07
120 0.06
121 0.05
122 0.03
123 0.03
124 0.03
125 0.03
126 0.03
127 0.02
128 0.02
129 0.02
130 0.02
131 0.02
132 0.02
133 0.02
134 0.02
135 0.03
136 0.03
137 0.03
138 0.03
139 0.03
140 0.03
141 0.03
142 0.03
143 0.03
144 0.03
145 0.03
146 0.03
147 0.03
148 0.03
149 0.05
150 0.06
151 0.11
152 0.14
153 0.15
154 0.21
155 0.31
156 0.4
157 0.48
158 0.58
159 0.63
160 0.71
161 0.82
162 0.86
163 0.87
164 0.87
165 0.88
166 0.84
167 0.77
168 0.68
169 0.64
170 0.58
171 0.51
172 0.41
173 0.31
174 0.25
175 0.22
176 0.19
177 0.12
178 0.07
179 0.04
180 0.04
181 0.03
182 0.03
183 0.03
184 0.03
185 0.04
186 0.04
187 0.06
188 0.06
189 0.07
190 0.08
191 0.11
192 0.12
193 0.12
194 0.12
195 0.11
196 0.12
197 0.12
198 0.12
199 0.11
200 0.18
201 0.19
202 0.19
203 0.23
204 0.26
205 0.26
206 0.32
207 0.32
208 0.29
209 0.35
210 0.4
211 0.44
212 0.48
213 0.47
214 0.4
215 0.4
216 0.37
217 0.32
218 0.27
219 0.18
220 0.12
221 0.12
222 0.12
223 0.1
224 0.09
225 0.07
226 0.06
227 0.07
228 0.08
229 0.09
230 0.11
231 0.11
232 0.11
233 0.11
234 0.12
235 0.12
236 0.14
237 0.14
238 0.15
239 0.16
240 0.18
241 0.19
242 0.22
243 0.28
244 0.27
245 0.26
246 0.25
247 0.24
248 0.24
249 0.24
250 0.21
251 0.15
252 0.14
253 0.14
254 0.13
255 0.12
256 0.1
257 0.09
258 0.1
259 0.08
260 0.08
261 0.1
262 0.12
263 0.13
264 0.14
265 0.16
266 0.21
267 0.25
268 0.28
269 0.27
270 0.25
271 0.25
272 0.25
273 0.22
274 0.16
275 0.13
276 0.09
277 0.08
278 0.07
279 0.06
280 0.05
281 0.05
282 0.05
283 0.03
284 0.03
285 0.03
286 0.03
287 0.03
288 0.03
289 0.04
290 0.04
291 0.05
292 0.05
293 0.05
294 0.06
295 0.06
296 0.06
297 0.06
298 0.07
299 0.08
300 0.11
301 0.13
302 0.16
303 0.17
304 0.22
305 0.32
306 0.4
307 0.43
308 0.45
309 0.46
310 0.48
311 0.55
312 0.52
313 0.44
314 0.42
315 0.38
316 0.37
317 0.39
318 0.37
319 0.31
320 0.28
321 0.26
322 0.21
323 0.19
324 0.16
325 0.1
326 0.07