Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4V1D9

Protein Details
Accession A0A4Q4V1D9    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
374-406ILEQPLAKNKGKSKNKKKKKSAKKDAKAEGGEEBasic
NLS Segment(s)
PositionSequence
381-400KNKGKSKNKKKKKSAKKDAK
Subcellular Location(s) cyto 18.5, cyto_nucl 12.333, nucl 5, mito_nucl 4.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR036005  Creatinase/aminopeptidase-like  
IPR047113  PA2G4/ARX1  
IPR000994  Pept_M24  
IPR036388  WH-like_DNA-bd_sf  
IPR036390  WH_DNA-bd_sf  
Pfam View protein in Pfam  
PF00557  Peptidase_M24  
CDD cd01089  PA2G4-like  
Amino Acid Sequences MAEKKEVDYTLSNPDNLTKWKTAAAISEKVLAAVSELCVAGEKIITICQKGDKLIEEEVAKVYRTTKHKGFAHPTTVSPSSYVTPYTPMSSDTAEANVELQAGEPIKIQLGAQIDGFGSIVCDTIIIGAEDVVTGRTAELMLATYYANELLLRLMMPPGLLAAGTEEEKTKATAVKPPTQTKISQLLEKAVKSYDCSLVESTTSWLFEHDEIEGKKKIVLAPAEGTKGEGTPEIGEVWGVEMGVSLGSGKVKTLEQRATLHRRTTNTYILKSQTARKTLSTIQSKFGHFPFSSRQLEEEGGDTKFKVGLFDGVRQGVLRQYELVGDKDNAPVARLLTTLAITKNGITKLGAPPALDVSKYQTDKKITDEEILKILEQPLAKNKGKSKNKKKKKSAKKDAKAEGGEEESGEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.32
3 0.34
4 0.37
5 0.31
6 0.3
7 0.32
8 0.33
9 0.31
10 0.35
11 0.36
12 0.34
13 0.33
14 0.36
15 0.33
16 0.31
17 0.29
18 0.21
19 0.16
20 0.13
21 0.12
22 0.09
23 0.09
24 0.08
25 0.09
26 0.1
27 0.09
28 0.08
29 0.08
30 0.07
31 0.12
32 0.14
33 0.14
34 0.16
35 0.2
36 0.21
37 0.23
38 0.25
39 0.23
40 0.25
41 0.26
42 0.28
43 0.24
44 0.24
45 0.25
46 0.24
47 0.21
48 0.18
49 0.2
50 0.23
51 0.28
52 0.34
53 0.36
54 0.44
55 0.5
56 0.58
57 0.63
58 0.62
59 0.65
60 0.59
61 0.55
62 0.53
63 0.49
64 0.4
65 0.32
66 0.28
67 0.22
68 0.21
69 0.21
70 0.15
71 0.17
72 0.17
73 0.19
74 0.17
75 0.16
76 0.17
77 0.17
78 0.17
79 0.15
80 0.14
81 0.13
82 0.12
83 0.11
84 0.09
85 0.08
86 0.07
87 0.06
88 0.07
89 0.08
90 0.08
91 0.08
92 0.08
93 0.09
94 0.09
95 0.09
96 0.1
97 0.11
98 0.11
99 0.11
100 0.11
101 0.11
102 0.11
103 0.11
104 0.07
105 0.05
106 0.05
107 0.05
108 0.04
109 0.04
110 0.04
111 0.04
112 0.05
113 0.04
114 0.04
115 0.04
116 0.04
117 0.04
118 0.04
119 0.04
120 0.04
121 0.04
122 0.04
123 0.04
124 0.04
125 0.04
126 0.04
127 0.04
128 0.04
129 0.05
130 0.05
131 0.05
132 0.05
133 0.05
134 0.05
135 0.04
136 0.04
137 0.04
138 0.04
139 0.04
140 0.04
141 0.05
142 0.05
143 0.05
144 0.04
145 0.04
146 0.04
147 0.03
148 0.03
149 0.04
150 0.05
151 0.05
152 0.06
153 0.06
154 0.07
155 0.08
156 0.08
157 0.08
158 0.1
159 0.11
160 0.17
161 0.21
162 0.28
163 0.34
164 0.38
165 0.41
166 0.41
167 0.4
168 0.39
169 0.43
170 0.36
171 0.33
172 0.3
173 0.31
174 0.31
175 0.3
176 0.27
177 0.19
178 0.17
179 0.16
180 0.18
181 0.16
182 0.15
183 0.16
184 0.16
185 0.15
186 0.15
187 0.14
188 0.13
189 0.1
190 0.09
191 0.08
192 0.08
193 0.08
194 0.08
195 0.08
196 0.07
197 0.11
198 0.11
199 0.15
200 0.16
201 0.15
202 0.15
203 0.16
204 0.17
205 0.16
206 0.16
207 0.15
208 0.16
209 0.18
210 0.18
211 0.17
212 0.16
213 0.12
214 0.12
215 0.1
216 0.08
217 0.07
218 0.06
219 0.06
220 0.06
221 0.06
222 0.05
223 0.05
224 0.05
225 0.05
226 0.04
227 0.03
228 0.03
229 0.03
230 0.03
231 0.03
232 0.03
233 0.03
234 0.04
235 0.04
236 0.04
237 0.05
238 0.07
239 0.1
240 0.16
241 0.18
242 0.21
243 0.25
244 0.33
245 0.4
246 0.43
247 0.45
248 0.44
249 0.44
250 0.47
251 0.47
252 0.48
253 0.44
254 0.43
255 0.41
256 0.4
257 0.41
258 0.38
259 0.41
260 0.38
261 0.38
262 0.37
263 0.34
264 0.36
265 0.37
266 0.43
267 0.45
268 0.4
269 0.42
270 0.45
271 0.45
272 0.44
273 0.4
274 0.37
275 0.28
276 0.29
277 0.29
278 0.33
279 0.34
280 0.32
281 0.32
282 0.29
283 0.3
284 0.27
285 0.23
286 0.18
287 0.16
288 0.16
289 0.14
290 0.13
291 0.13
292 0.13
293 0.11
294 0.1
295 0.15
296 0.17
297 0.21
298 0.23
299 0.22
300 0.22
301 0.21
302 0.21
303 0.18
304 0.17
305 0.14
306 0.12
307 0.12
308 0.15
309 0.17
310 0.18
311 0.17
312 0.17
313 0.17
314 0.18
315 0.21
316 0.17
317 0.16
318 0.16
319 0.14
320 0.14
321 0.13
322 0.12
323 0.1
324 0.11
325 0.13
326 0.12
327 0.13
328 0.13
329 0.14
330 0.18
331 0.17
332 0.17
333 0.16
334 0.19
335 0.22
336 0.27
337 0.27
338 0.23
339 0.23
340 0.27
341 0.28
342 0.24
343 0.2
344 0.21
345 0.28
346 0.31
347 0.33
348 0.35
349 0.39
350 0.4
351 0.44
352 0.45
353 0.39
354 0.43
355 0.43
356 0.39
357 0.38
358 0.37
359 0.32
360 0.27
361 0.26
362 0.22
363 0.2
364 0.21
365 0.26
366 0.34
367 0.38
368 0.42
369 0.5
370 0.57
371 0.67
372 0.75
373 0.78
374 0.81
375 0.88
376 0.93
377 0.96
378 0.96
379 0.96
380 0.97
381 0.97
382 0.97
383 0.96
384 0.95
385 0.93
386 0.91
387 0.83
388 0.73
389 0.66
390 0.58
391 0.48