Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4W7E8

Protein Details
Accession A0A4Q4W7E8   
Localization Confidence High
Confidence Score 17.7
NoLS Segment(s)
PositionSequenceProtein Nature
14-33ICRRKDAKSARIKKNTKSSQHydrophilic
62-82LPPNLQIKEVPKKNKKGKHTAHydrophilic
NLS Segment(s)
PositionSequence
23-26ARIK
72-80PKKNKKGKH
Subcellular Location(s) nucl 21.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002675  Ribosomal_L38e  
IPR038464  Ribosomal_L38e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01781  Ribosomal_L38e  
Amino Acid Sequences MPQEIGDIKKFIEICRRKDAKSARIKKNTKSSQTKFKVRCSKHLYTLVLKDSDKAEKLKQSLPPNLQIKEVPKKNKKGKHTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.47
3 0.51
4 0.48
5 0.56
6 0.62
7 0.61
8 0.65
9 0.69
10 0.69
11 0.75
12 0.79
13 0.78
14 0.81
15 0.79
16 0.78
17 0.78
18 0.73
19 0.73
20 0.76
21 0.77
22 0.71
23 0.72
24 0.72
25 0.64
26 0.69
27 0.66
28 0.62
29 0.59
30 0.6
31 0.53
32 0.47
33 0.48
34 0.41
35 0.35
36 0.31
37 0.26
38 0.23
39 0.23
40 0.21
41 0.21
42 0.22
43 0.24
44 0.27
45 0.31
46 0.36
47 0.4
48 0.46
49 0.48
50 0.53
51 0.54
52 0.52
53 0.49
54 0.46
55 0.46
56 0.49
57 0.53
58 0.55
59 0.59
60 0.68
61 0.76
62 0.81