Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4VZH7

Protein Details
Accession A0A4Q4VZH7   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
115-134ADGPKPEQVKKAKRVQPLQKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19.5, mito_nucl 11.166, cyto 6, cyto_nucl 4.833
Family & Domain DBs
Amino Acid Sequences MPAVIVKIPAHTAPSADKLSLLSQQLKRLTVSELREVILALCITGPLYRAFYDEVFQAVESYLVKKGCQSARDGLPPRLFDLGDGELQGVVLEVSEKSEIACKRAMCMAEKIIGADGPKPEQVKKAKRVQPLQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.23
3 0.21
4 0.2
5 0.19
6 0.21
7 0.23
8 0.23
9 0.26
10 0.27
11 0.34
12 0.36
13 0.36
14 0.34
15 0.31
16 0.32
17 0.3
18 0.3
19 0.29
20 0.27
21 0.26
22 0.26
23 0.24
24 0.21
25 0.17
26 0.13
27 0.07
28 0.06
29 0.05
30 0.06
31 0.06
32 0.07
33 0.06
34 0.07
35 0.08
36 0.09
37 0.1
38 0.1
39 0.11
40 0.1
41 0.1
42 0.09
43 0.08
44 0.07
45 0.06
46 0.06
47 0.06
48 0.07
49 0.08
50 0.08
51 0.08
52 0.09
53 0.14
54 0.16
55 0.17
56 0.18
57 0.21
58 0.23
59 0.31
60 0.34
61 0.33
62 0.34
63 0.33
64 0.32
65 0.28
66 0.25
67 0.18
68 0.18
69 0.15
70 0.12
71 0.11
72 0.1
73 0.08
74 0.08
75 0.08
76 0.05
77 0.03
78 0.03
79 0.03
80 0.03
81 0.04
82 0.05
83 0.05
84 0.05
85 0.11
86 0.12
87 0.14
88 0.18
89 0.17
90 0.19
91 0.23
92 0.24
93 0.22
94 0.25
95 0.25
96 0.24
97 0.24
98 0.23
99 0.2
100 0.19
101 0.17
102 0.16
103 0.16
104 0.15
105 0.19
106 0.21
107 0.23
108 0.3
109 0.39
110 0.46
111 0.53
112 0.61
113 0.64
114 0.72