Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G9N4R0

Protein Details
Accession G9N4R0    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
51-77NTGNDKMRMKSRKRNKREKTNTQSIRLHydrophilic
NLS Segment(s)
PositionSequence
38-69KATRASSPGKMRLNTGNDKMRMKSRKRNKREK
Subcellular Location(s) nucl 15.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
Amino Acid Sequences MDGAVSGLSGWLATQHKGKVWSGCEPCLVRAKGNKTSKATRASSPGKMRLNTGNDKMRMKSRKRNKREKTNTQSIRLPEEGGREGIKGNSSRWRSMINSELTLTLTLTLTNRTRTDQDRPGQTGQTPNNQR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.18
3 0.22
4 0.26
5 0.29
6 0.3
7 0.32
8 0.39
9 0.38
10 0.38
11 0.4
12 0.38
13 0.38
14 0.41
15 0.38
16 0.33
17 0.37
18 0.42
19 0.46
20 0.52
21 0.55
22 0.53
23 0.58
24 0.6
25 0.6
26 0.57
27 0.5
28 0.51
29 0.49
30 0.51
31 0.5
32 0.52
33 0.49
34 0.47
35 0.46
36 0.45
37 0.46
38 0.43
39 0.43
40 0.42
41 0.4
42 0.41
43 0.4
44 0.42
45 0.45
46 0.47
47 0.51
48 0.55
49 0.63
50 0.7
51 0.8
52 0.81
53 0.84
54 0.88
55 0.89
56 0.88
57 0.88
58 0.83
59 0.76
60 0.71
61 0.61
62 0.55
63 0.45
64 0.37
65 0.27
66 0.25
67 0.22
68 0.19
69 0.17
70 0.13
71 0.13
72 0.13
73 0.15
74 0.13
75 0.14
76 0.21
77 0.24
78 0.25
79 0.26
80 0.29
81 0.28
82 0.31
83 0.35
84 0.3
85 0.28
86 0.28
87 0.27
88 0.24
89 0.22
90 0.18
91 0.12
92 0.09
93 0.09
94 0.09
95 0.13
96 0.15
97 0.19
98 0.21
99 0.23
100 0.28
101 0.32
102 0.4
103 0.44
104 0.49
105 0.52
106 0.56
107 0.57
108 0.55
109 0.53
110 0.54
111 0.5