Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G9MVG1

Protein Details
Accession G9MVG1    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
11-39NSRRIRSRIAQQAYRKRHNEKFHSSQRRAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 13, cyto 7.5
Family & Domain DBs
Amino Acid Sequences MSSPEEQSTANSRRIRSRIAQQAYRKRHNEKFHSSQRRAQDLQIAAQRACTVFTDLTGALIQSGIMQQDTALTTEVLNAIKKFHHVAKVVNEDGQHFGSGDVDQLLGHDIGIPNETMAIRYDDRIHPTMMSEVQLDIEKGKNIFHFGGEAASTQDQLDQNAYS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.53
3 0.5
4 0.56
5 0.58
6 0.62
7 0.67
8 0.68
9 0.75
10 0.78
11 0.81
12 0.79
13 0.77
14 0.78
15 0.79
16 0.78
17 0.77
18 0.77
19 0.79
20 0.82
21 0.79
22 0.77
23 0.74
24 0.73
25 0.65
26 0.57
27 0.53
28 0.43
29 0.44
30 0.42
31 0.36
32 0.28
33 0.27
34 0.26
35 0.19
36 0.18
37 0.14
38 0.12
39 0.09
40 0.1
41 0.11
42 0.1
43 0.11
44 0.1
45 0.09
46 0.06
47 0.06
48 0.06
49 0.04
50 0.05
51 0.04
52 0.04
53 0.04
54 0.04
55 0.05
56 0.05
57 0.06
58 0.06
59 0.06
60 0.06
61 0.06
62 0.07
63 0.07
64 0.08
65 0.07
66 0.08
67 0.08
68 0.09
69 0.11
70 0.12
71 0.16
72 0.17
73 0.19
74 0.24
75 0.29
76 0.29
77 0.28
78 0.26
79 0.22
80 0.23
81 0.2
82 0.14
83 0.1
84 0.09
85 0.08
86 0.08
87 0.07
88 0.05
89 0.05
90 0.05
91 0.05
92 0.06
93 0.05
94 0.05
95 0.06
96 0.06
97 0.07
98 0.07
99 0.07
100 0.06
101 0.07
102 0.07
103 0.06
104 0.07
105 0.11
106 0.11
107 0.12
108 0.16
109 0.18
110 0.24
111 0.25
112 0.25
113 0.21
114 0.22
115 0.23
116 0.2
117 0.19
118 0.14
119 0.12
120 0.13
121 0.13
122 0.12
123 0.12
124 0.12
125 0.14
126 0.13
127 0.15
128 0.15
129 0.18
130 0.19
131 0.17
132 0.17
133 0.15
134 0.16
135 0.14
136 0.14
137 0.13
138 0.13
139 0.13
140 0.12
141 0.16
142 0.15
143 0.16