Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q4VNX7

Protein Details
Accession A0A4Q4VNX7    Localization Confidence High Confidence Score 16
NoLS Segment(s)
PositionSequenceProtein Nature
41-63GAAVSEKKLKRKRDGGKADDAPRBasic
204-228EMQNSTSGKKKKKGKKTKYLGEVDDHydrophilic
NLS Segment(s)
PositionSequence
31-95EKQKNASAKKGAAVSEKKLKRKRDGGKADDAPRAFKRLMAYASGKKPRSGLDNGEETRGKSKKRK
211-220GKKKKKGKKT
Subcellular Location(s) nucl 14.5, cyto_nucl 10.5, mito 6, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038871  C607.02c-like  
Amino Acid Sequences MPHKHTRREKDPSTFDLPPSQFAKPLPVRQEKQKNASAKKGAAVSEKKLKRKRDGGKADDAPRAFKRLMAYASGKKPRSGLDNGEETRGKSKKRKATQTAASEGEAKETHEVPKIRPGERMSDFAARVDAALPISGLVNKSVRDGKDPLGLKVWRTNKERKMHKLYDEWREEERKIKEKREEELELQAERELEEEEVGVSWKIEMQNSTSGKKKKKGKKTKYLGEVDDAEDDPWEALKKKRGETRAGLHDVVQAPPELAIKPQKKMTVRGAAVEVDGIPKAAGSLRRREELQTIRDDVVTSYRKMMSEKRPAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.61
3 0.6
4 0.53
5 0.48
6 0.45
7 0.39
8 0.34
9 0.32
10 0.4
11 0.37
12 0.43
13 0.48
14 0.54
15 0.57
16 0.65
17 0.75
18 0.73
19 0.74
20 0.74
21 0.74
22 0.71
23 0.76
24 0.71
25 0.62
26 0.58
27 0.54
28 0.5
29 0.49
30 0.47
31 0.44
32 0.48
33 0.52
34 0.58
35 0.63
36 0.68
37 0.69
38 0.74
39 0.78
40 0.79
41 0.82
42 0.78
43 0.81
44 0.8
45 0.76
46 0.72
47 0.63
48 0.57
49 0.49
50 0.47
51 0.37
52 0.31
53 0.28
54 0.27
55 0.27
56 0.27
57 0.31
58 0.34
59 0.43
60 0.49
61 0.48
62 0.44
63 0.44
64 0.42
65 0.42
66 0.39
67 0.35
68 0.32
69 0.39
70 0.39
71 0.42
72 0.4
73 0.35
74 0.38
75 0.37
76 0.38
77 0.38
78 0.46
79 0.52
80 0.61
81 0.7
82 0.71
83 0.76
84 0.79
85 0.77
86 0.73
87 0.65
88 0.56
89 0.48
90 0.4
91 0.33
92 0.24
93 0.18
94 0.15
95 0.15
96 0.15
97 0.18
98 0.2
99 0.18
100 0.26
101 0.3
102 0.29
103 0.33
104 0.33
105 0.35
106 0.36
107 0.37
108 0.32
109 0.31
110 0.3
111 0.25
112 0.24
113 0.17
114 0.14
115 0.12
116 0.1
117 0.06
118 0.05
119 0.05
120 0.04
121 0.05
122 0.05
123 0.05
124 0.06
125 0.07
126 0.07
127 0.1
128 0.13
129 0.14
130 0.16
131 0.18
132 0.19
133 0.24
134 0.25
135 0.23
136 0.25
137 0.25
138 0.23
139 0.28
140 0.32
141 0.33
142 0.37
143 0.44
144 0.46
145 0.55
146 0.61
147 0.63
148 0.66
149 0.63
150 0.62
151 0.63
152 0.61
153 0.61
154 0.57
155 0.51
156 0.46
157 0.44
158 0.41
159 0.4
160 0.39
161 0.39
162 0.4
163 0.44
164 0.49
165 0.49
166 0.52
167 0.51
168 0.5
169 0.43
170 0.44
171 0.4
172 0.32
173 0.29
174 0.26
175 0.19
176 0.15
177 0.14
178 0.08
179 0.06
180 0.06
181 0.05
182 0.05
183 0.05
184 0.06
185 0.05
186 0.04
187 0.04
188 0.06
189 0.07
190 0.08
191 0.09
192 0.1
193 0.18
194 0.21
195 0.23
196 0.29
197 0.35
198 0.41
199 0.49
200 0.57
201 0.59
202 0.68
203 0.77
204 0.8
205 0.84
206 0.88
207 0.89
208 0.89
209 0.85
210 0.76
211 0.69
212 0.6
213 0.5
214 0.42
215 0.33
216 0.23
217 0.17
218 0.15
219 0.1
220 0.09
221 0.1
222 0.1
223 0.14
224 0.21
225 0.27
226 0.33
227 0.41
228 0.45
229 0.5
230 0.55
231 0.59
232 0.6
233 0.6
234 0.54
235 0.47
236 0.47
237 0.41
238 0.35
239 0.27
240 0.18
241 0.14
242 0.14
243 0.15
244 0.1
245 0.12
246 0.21
247 0.24
248 0.28
249 0.33
250 0.39
251 0.42
252 0.48
253 0.53
254 0.53
255 0.51
256 0.49
257 0.47
258 0.4
259 0.37
260 0.31
261 0.22
262 0.14
263 0.12
264 0.1
265 0.07
266 0.06
267 0.07
268 0.1
269 0.17
270 0.2
271 0.3
272 0.34
273 0.38
274 0.4
275 0.43
276 0.49
277 0.49
278 0.51
279 0.48
280 0.47
281 0.45
282 0.43
283 0.41
284 0.33
285 0.33
286 0.31
287 0.26
288 0.27
289 0.28
290 0.29
291 0.33
292 0.4
293 0.42