Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q4V8H7

Protein Details
Accession A0A4Q4V8H7    Localization Confidence High Confidence Score 17.7
NoLS Segment(s)
PositionSequenceProtein Nature
23-52KLSRHPDKLYSSRKRRVKRLKQSGNCTDDFHydrophilic
NLS Segment(s)
PositionSequence
35-41RKRRVKR
125-137AEKGEKKGGKKPR
Subcellular Location(s) nucl 20, cyto 4, pero 2
Family & Domain DBs
Amino Acid Sequences MDHLDIYSVTSWDGESFKAQAFKLSRHPDKLYSSRKRRVKRLKQSGNCTDDFEQGHSRYLISPAPPPEKPRGQGVKQPAKPKQNDSSEHQFPGLGPSGECITSPAMDSAKPNSGPKTGPGSESGAEKGEKKGGKKPRILLVSVPLGAELFARYYSWSPLAAAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.13
4 0.15
5 0.19
6 0.19
7 0.24
8 0.26
9 0.28
10 0.36
11 0.44
12 0.48
13 0.5
14 0.54
15 0.52
16 0.57
17 0.63
18 0.64
19 0.65
20 0.69
21 0.72
22 0.78
23 0.81
24 0.84
25 0.86
26 0.86
27 0.87
28 0.88
29 0.9
30 0.89
31 0.91
32 0.89
33 0.83
34 0.72
35 0.66
36 0.56
37 0.49
38 0.41
39 0.34
40 0.3
41 0.25
42 0.26
43 0.21
44 0.2
45 0.17
46 0.18
47 0.16
48 0.13
49 0.16
50 0.19
51 0.23
52 0.24
53 0.27
54 0.32
55 0.34
56 0.34
57 0.38
58 0.41
59 0.39
60 0.43
61 0.49
62 0.53
63 0.53
64 0.59
65 0.58
66 0.58
67 0.58
68 0.58
69 0.56
70 0.53
71 0.52
72 0.51
73 0.52
74 0.47
75 0.45
76 0.4
77 0.32
78 0.25
79 0.25
80 0.2
81 0.12
82 0.1
83 0.1
84 0.11
85 0.11
86 0.11
87 0.09
88 0.07
89 0.07
90 0.08
91 0.09
92 0.08
93 0.09
94 0.1
95 0.12
96 0.16
97 0.17
98 0.19
99 0.2
100 0.22
101 0.22
102 0.24
103 0.29
104 0.26
105 0.25
106 0.25
107 0.26
108 0.25
109 0.26
110 0.24
111 0.18
112 0.18
113 0.18
114 0.18
115 0.21
116 0.24
117 0.25
118 0.33
119 0.41
120 0.48
121 0.54
122 0.58
123 0.6
124 0.61
125 0.6
126 0.54
127 0.49
128 0.46
129 0.39
130 0.34
131 0.25
132 0.2
133 0.18
134 0.16
135 0.11
136 0.07
137 0.07
138 0.07
139 0.1
140 0.11
141 0.15
142 0.16
143 0.16