Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4V1B6

Protein Details
Accession A0A4Q4V1B6    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
68-106EEAGPPRPKGSRRRRRRMRTSRLRWRRRRRRKRGEGDEKBasic
NLS Segment(s)
PositionSequence
72-106PPRPKGSRRRRRRMRTSRLRWRRRRRRKRGEGDEK
Subcellular Location(s) mito 12.5, cyto_mito 9.5, nucl 8, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MVAQQMKTWGQIKGKLGLNTTAKPLPEPAYEVRKAAGKEKAVESLAARRAAVGAADGLGNLQDDSDEEEAGPPRPKGSRRRRRRMRTSRLRWRRRRRRKRGEGDEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.41
3 0.41
4 0.43
5 0.43
6 0.38
7 0.4
8 0.35
9 0.29
10 0.28
11 0.28
12 0.25
13 0.21
14 0.24
15 0.24
16 0.28
17 0.29
18 0.29
19 0.27
20 0.27
21 0.27
22 0.28
23 0.29
24 0.24
25 0.26
26 0.27
27 0.29
28 0.25
29 0.25
30 0.21
31 0.21
32 0.22
33 0.2
34 0.18
35 0.15
36 0.15
37 0.14
38 0.13
39 0.07
40 0.04
41 0.03
42 0.03
43 0.03
44 0.03
45 0.03
46 0.03
47 0.03
48 0.03
49 0.02
50 0.03
51 0.06
52 0.07
53 0.07
54 0.07
55 0.08
56 0.1
57 0.13
58 0.15
59 0.12
60 0.14
61 0.19
62 0.25
63 0.35
64 0.45
65 0.53
66 0.62
67 0.74
68 0.83
69 0.89
70 0.94
71 0.95
72 0.95
73 0.95
74 0.95
75 0.95
76 0.95
77 0.96
78 0.95
79 0.95
80 0.96
81 0.96
82 0.96
83 0.96
84 0.97
85 0.97
86 0.97