Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q4W1W6

Protein Details
Accession A0A4Q4W1W6    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
208-233LETKLSTRARERWRRLKRPQCFKAASHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, mito 9, cyto 3
Family & Domain DBs
Amino Acid Sequences MSKHHREIVRSCLVQELRQLDQTHRMIVMLLECEHPGWGDPGAEAAHEAALAIVQETFRTRPKLSSQEISEIRKKDRETAGLNRSIAQLPSHQFSQSNCLARPGRSLQPSSLELTKDRHIASNGPDPKDIALPMDDDDNLQVQQAQLSTPLCRDASVNCTILTNRDHAEAMRRLDRCSVTPSGLAQLEAQRTTVWNRISQIDAAQKELETKLSTRARERWRRLKRPQCFKAASLGLSRGRGSRLSSYTAIDDVDDPFGERNARCERGALWEPEFKPRDREVIW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.43
3 0.38
4 0.32
5 0.37
6 0.38
7 0.33
8 0.4
9 0.4
10 0.36
11 0.32
12 0.28
13 0.23
14 0.22
15 0.21
16 0.15
17 0.14
18 0.13
19 0.13
20 0.13
21 0.13
22 0.12
23 0.11
24 0.1
25 0.1
26 0.09
27 0.08
28 0.1
29 0.1
30 0.09
31 0.09
32 0.08
33 0.07
34 0.06
35 0.06
36 0.04
37 0.04
38 0.04
39 0.04
40 0.04
41 0.04
42 0.05
43 0.07
44 0.1
45 0.15
46 0.19
47 0.2
48 0.24
49 0.32
50 0.39
51 0.43
52 0.47
53 0.45
54 0.5
55 0.54
56 0.55
57 0.54
58 0.5
59 0.48
60 0.47
61 0.45
62 0.44
63 0.44
64 0.44
65 0.43
66 0.48
67 0.51
68 0.51
69 0.5
70 0.43
71 0.41
72 0.36
73 0.3
74 0.22
75 0.2
76 0.17
77 0.2
78 0.19
79 0.18
80 0.18
81 0.18
82 0.24
83 0.24
84 0.25
85 0.23
86 0.28
87 0.29
88 0.28
89 0.32
90 0.31
91 0.32
92 0.32
93 0.33
94 0.28
95 0.3
96 0.31
97 0.29
98 0.27
99 0.22
100 0.2
101 0.22
102 0.22
103 0.21
104 0.2
105 0.2
106 0.18
107 0.2
108 0.22
109 0.28
110 0.31
111 0.29
112 0.29
113 0.27
114 0.27
115 0.25
116 0.21
117 0.13
118 0.09
119 0.08
120 0.08
121 0.08
122 0.07
123 0.07
124 0.07
125 0.07
126 0.06
127 0.05
128 0.06
129 0.05
130 0.05
131 0.05
132 0.05
133 0.06
134 0.07
135 0.07
136 0.07
137 0.09
138 0.09
139 0.09
140 0.09
141 0.09
142 0.13
143 0.16
144 0.16
145 0.14
146 0.15
147 0.15
148 0.17
149 0.17
150 0.14
151 0.12
152 0.12
153 0.12
154 0.12
155 0.18
156 0.2
157 0.22
158 0.26
159 0.26
160 0.25
161 0.29
162 0.3
163 0.25
164 0.26
165 0.25
166 0.21
167 0.2
168 0.2
169 0.19
170 0.18
171 0.17
172 0.14
173 0.15
174 0.15
175 0.15
176 0.15
177 0.12
178 0.13
179 0.15
180 0.19
181 0.18
182 0.18
183 0.2
184 0.21
185 0.23
186 0.22
187 0.23
188 0.25
189 0.24
190 0.24
191 0.22
192 0.2
193 0.21
194 0.21
195 0.19
196 0.14
197 0.14
198 0.21
199 0.25
200 0.29
201 0.32
202 0.41
203 0.49
204 0.58
205 0.67
206 0.69
207 0.75
208 0.83
209 0.88
210 0.9
211 0.9
212 0.9
213 0.88
214 0.87
215 0.8
216 0.71
217 0.68
218 0.61
219 0.53
220 0.44
221 0.42
222 0.35
223 0.33
224 0.33
225 0.26
226 0.25
227 0.24
228 0.25
229 0.27
230 0.27
231 0.3
232 0.3
233 0.31
234 0.3
235 0.29
236 0.25
237 0.2
238 0.18
239 0.14
240 0.14
241 0.12
242 0.12
243 0.11
244 0.13
245 0.16
246 0.15
247 0.21
248 0.27
249 0.3
250 0.3
251 0.31
252 0.3
253 0.35
254 0.41
255 0.39
256 0.36
257 0.41
258 0.42
259 0.5
260 0.53
261 0.46
262 0.46
263 0.44