Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4V5B6

Protein Details
Accession A0A4Q4V5B6   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
327-347ATMLSKVLRRRQNARDFRRTVHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 27
Family & Domain DBs
InterPro View protein in InterPro  
IPR021476  Egh16-like  
Pfam View protein in Pfam  
PF11327  Egh16-like  
Amino Acid Sequences MPSFKAILAFSVLATAPLVAGHAAIVDATGDLGGTGMALGVDTSTPRDGTRRRPFQQDSTRFRGDQEDTIGETIGAGNNDVEAGTAAILAETGGQPLPQVSPGGELSMTLHQVNADGAGPYTCQINADGTGQTWQNIQVTQSPPGDDSRDRDGAATDFPMTAAIPADQQCTGTVAGQENICLVRCMNGARAGPFGGVVPVQMAAAGNTGNAGNTGNIGNGVNTGNGVNTGNGVNTGNGVNTGNGVNAGNGVNTGNGFDTGNGVNTGNGVNTGNGFNTGNGVNTGNGDNTGTEDSTGNGDNTGDEDDNENGFNTNDRRAANKPAKRNATMLSKVLRRRQNARDFRRTVTPEDFEFGMYQEED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.1
3 0.07
4 0.06
5 0.07
6 0.05
7 0.05
8 0.04
9 0.04
10 0.04
11 0.04
12 0.04
13 0.04
14 0.04
15 0.04
16 0.03
17 0.03
18 0.03
19 0.03
20 0.03
21 0.03
22 0.03
23 0.03
24 0.03
25 0.03
26 0.03
27 0.03
28 0.04
29 0.04
30 0.07
31 0.08
32 0.09
33 0.1
34 0.18
35 0.23
36 0.34
37 0.45
38 0.53
39 0.56
40 0.65
41 0.7
42 0.73
43 0.79
44 0.78
45 0.76
46 0.74
47 0.74
48 0.64
49 0.6
50 0.56
51 0.48
52 0.41
53 0.37
54 0.31
55 0.28
56 0.28
57 0.27
58 0.19
59 0.16
60 0.13
61 0.1
62 0.08
63 0.07
64 0.06
65 0.06
66 0.06
67 0.06
68 0.06
69 0.04
70 0.04
71 0.04
72 0.04
73 0.04
74 0.03
75 0.03
76 0.03
77 0.04
78 0.04
79 0.05
80 0.05
81 0.05
82 0.05
83 0.06
84 0.07
85 0.07
86 0.07
87 0.06
88 0.09
89 0.09
90 0.1
91 0.09
92 0.09
93 0.1
94 0.12
95 0.13
96 0.1
97 0.1
98 0.09
99 0.1
100 0.1
101 0.08
102 0.07
103 0.05
104 0.06
105 0.06
106 0.06
107 0.06
108 0.07
109 0.06
110 0.06
111 0.06
112 0.07
113 0.08
114 0.1
115 0.1
116 0.09
117 0.11
118 0.11
119 0.11
120 0.1
121 0.1
122 0.1
123 0.1
124 0.1
125 0.14
126 0.16
127 0.2
128 0.2
129 0.19
130 0.19
131 0.2
132 0.23
133 0.18
134 0.2
135 0.21
136 0.22
137 0.21
138 0.2
139 0.2
140 0.17
141 0.17
142 0.14
143 0.09
144 0.08
145 0.07
146 0.07
147 0.06
148 0.06
149 0.05
150 0.05
151 0.06
152 0.07
153 0.08
154 0.08
155 0.08
156 0.08
157 0.09
158 0.09
159 0.08
160 0.08
161 0.08
162 0.09
163 0.09
164 0.09
165 0.08
166 0.08
167 0.07
168 0.06
169 0.06
170 0.06
171 0.07
172 0.07
173 0.08
174 0.12
175 0.12
176 0.13
177 0.14
178 0.12
179 0.12
180 0.11
181 0.09
182 0.06
183 0.05
184 0.05
185 0.04
186 0.04
187 0.04
188 0.04
189 0.04
190 0.03
191 0.04
192 0.04
193 0.03
194 0.04
195 0.04
196 0.04
197 0.04
198 0.04
199 0.04
200 0.05
201 0.05
202 0.05
203 0.06
204 0.06
205 0.05
206 0.06
207 0.07
208 0.06
209 0.06
210 0.06
211 0.05
212 0.06
213 0.06
214 0.05
215 0.06
216 0.06
217 0.06
218 0.07
219 0.07
220 0.06
221 0.07
222 0.07
223 0.06
224 0.07
225 0.07
226 0.06
227 0.07
228 0.07
229 0.06
230 0.07
231 0.07
232 0.06
233 0.07
234 0.07
235 0.06
236 0.06
237 0.06
238 0.06
239 0.05
240 0.06
241 0.05
242 0.06
243 0.06
244 0.06
245 0.08
246 0.08
247 0.09
248 0.09
249 0.09
250 0.08
251 0.09
252 0.09
253 0.07
254 0.07
255 0.07
256 0.06
257 0.07
258 0.08
259 0.07
260 0.09
261 0.09
262 0.09
263 0.1
264 0.1
265 0.1
266 0.1
267 0.11
268 0.1
269 0.11
270 0.12
271 0.1
272 0.1
273 0.1
274 0.09
275 0.1
276 0.11
277 0.1
278 0.1
279 0.1
280 0.1
281 0.12
282 0.13
283 0.11
284 0.1
285 0.1
286 0.09
287 0.1
288 0.13
289 0.11
290 0.1
291 0.12
292 0.13
293 0.14
294 0.15
295 0.14
296 0.11
297 0.11
298 0.15
299 0.15
300 0.18
301 0.21
302 0.22
303 0.26
304 0.29
305 0.4
306 0.46
307 0.51
308 0.56
309 0.62
310 0.69
311 0.67
312 0.67
313 0.63
314 0.62
315 0.59
316 0.54
317 0.52
318 0.52
319 0.57
320 0.62
321 0.63
322 0.61
323 0.65
324 0.71
325 0.74
326 0.78
327 0.8
328 0.82
329 0.79
330 0.76
331 0.77
332 0.71
333 0.66
334 0.63
335 0.57
336 0.49
337 0.48
338 0.44
339 0.35
340 0.31
341 0.26