Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4V1XJZ3

Protein Details
Accession A0A4V1XJZ3    Localization Confidence Low Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
18-38ICFPDPHFKHRKQKARIVSTTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 11.5, cyto_nucl 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029063  SAM-dependent_MTases_sf  
IPR003358  tRNA_(Gua-N-7)_MeTrfase_Trmb  
Gene Ontology GO:0008176  F:tRNA (guanine-N7-)-methyltransferase activity  
Pfam View protein in Pfam  
PF02390  Methyltransf_4  
PROSITE View protein in PROSITE  
PS51625  SAM_MT_TRMB  
Amino Acid Sequences MKFLPNFFRKGQLSKVFICFPDPHFKHRKQKARIVSTTLNSEYAYVLRPGGIVYTITDVLDLHNWMVQHLEAHPSFERVSEEEQEADPSVAIMRTETEEGKKVERNKGQKFVALFRRLENPAW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.52
3 0.47
4 0.43
5 0.43
6 0.37
7 0.33
8 0.39
9 0.37
10 0.41
11 0.46
12 0.55
13 0.61
14 0.68
15 0.75
16 0.71
17 0.78
18 0.81
19 0.81
20 0.76
21 0.72
22 0.67
23 0.6
24 0.56
25 0.48
26 0.39
27 0.29
28 0.26
29 0.19
30 0.15
31 0.13
32 0.09
33 0.08
34 0.07
35 0.07
36 0.06
37 0.06
38 0.06
39 0.05
40 0.05
41 0.06
42 0.07
43 0.06
44 0.06
45 0.06
46 0.06
47 0.07
48 0.06
49 0.05
50 0.06
51 0.06
52 0.06
53 0.06
54 0.06
55 0.06
56 0.06
57 0.1
58 0.09
59 0.12
60 0.12
61 0.13
62 0.13
63 0.14
64 0.15
65 0.12
66 0.15
67 0.15
68 0.15
69 0.15
70 0.15
71 0.16
72 0.15
73 0.13
74 0.1
75 0.08
76 0.08
77 0.07
78 0.07
79 0.06
80 0.06
81 0.08
82 0.1
83 0.12
84 0.14
85 0.18
86 0.2
87 0.24
88 0.29
89 0.33
90 0.41
91 0.48
92 0.55
93 0.59
94 0.65
95 0.64
96 0.62
97 0.6
98 0.59
99 0.6
100 0.57
101 0.5
102 0.45
103 0.5