Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4VIQ0

Protein Details
Accession A0A4Q4VIQ0   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
220-246AAMNGTTRKKPGRPKKEKNAPAPVGRTHydrophilic
NLS Segment(s)
PositionSequence
224-249GTTRKKPGRPKKEKNAPAPVGRTLRK
Subcellular Location(s) cyto_nucl 12.833, nucl 12.5, cyto 11, mito_nucl 8.166
Family & Domain DBs
Amino Acid Sequences MADTTVEVSNKVAQLEPTSNGVPTTNFETKASGAIDADTGKTAEAPLAPADPGKQAVVASVDVSEPTNQEPPSIAKGDLSSKVDAADTLAQQPEKQTDQVPTPVSQEPVAESTETAATAPDAQSKLSPKPVSVEEVKDEEMPTVNPTTTGAPQTDGAAKAASNPTSEPGPEKTDAEKPEPDTGDKRKADEADNTPVETKPTQDGAVADEPAEKKQKANGAAMNGTTRKKPGRPKKEKNAPAPVGRTLRKTRSQGAAEVQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.23
3 0.24
4 0.24
5 0.23
6 0.23
7 0.22
8 0.21
9 0.18
10 0.17
11 0.23
12 0.23
13 0.24
14 0.24
15 0.26
16 0.26
17 0.28
18 0.26
19 0.19
20 0.15
21 0.14
22 0.14
23 0.13
24 0.13
25 0.1
26 0.1
27 0.09
28 0.09
29 0.08
30 0.08
31 0.08
32 0.08
33 0.08
34 0.09
35 0.1
36 0.1
37 0.11
38 0.11
39 0.12
40 0.11
41 0.1
42 0.09
43 0.1
44 0.11
45 0.11
46 0.09
47 0.09
48 0.08
49 0.08
50 0.09
51 0.09
52 0.08
53 0.1
54 0.14
55 0.14
56 0.14
57 0.15
58 0.17
59 0.2
60 0.21
61 0.19
62 0.15
63 0.17
64 0.2
65 0.23
66 0.23
67 0.19
68 0.17
69 0.18
70 0.17
71 0.15
72 0.14
73 0.12
74 0.1
75 0.11
76 0.13
77 0.12
78 0.12
79 0.14
80 0.15
81 0.14
82 0.15
83 0.15
84 0.15
85 0.18
86 0.22
87 0.22
88 0.2
89 0.22
90 0.22
91 0.21
92 0.19
93 0.17
94 0.14
95 0.14
96 0.13
97 0.1
98 0.08
99 0.08
100 0.08
101 0.08
102 0.07
103 0.05
104 0.05
105 0.05
106 0.06
107 0.07
108 0.08
109 0.08
110 0.1
111 0.12
112 0.14
113 0.19
114 0.19
115 0.17
116 0.19
117 0.2
118 0.21
119 0.21
120 0.21
121 0.17
122 0.18
123 0.19
124 0.17
125 0.16
126 0.13
127 0.11
128 0.1
129 0.1
130 0.09
131 0.08
132 0.07
133 0.08
134 0.1
135 0.1
136 0.11
137 0.1
138 0.1
139 0.11
140 0.12
141 0.13
142 0.12
143 0.11
144 0.1
145 0.09
146 0.11
147 0.13
148 0.12
149 0.11
150 0.11
151 0.12
152 0.12
153 0.13
154 0.13
155 0.14
156 0.17
157 0.17
158 0.19
159 0.2
160 0.26
161 0.28
162 0.3
163 0.3
164 0.29
165 0.34
166 0.33
167 0.33
168 0.34
169 0.37
170 0.42
171 0.4
172 0.39
173 0.38
174 0.39
175 0.39
176 0.4
177 0.39
178 0.38
179 0.38
180 0.37
181 0.34
182 0.32
183 0.32
184 0.25
185 0.22
186 0.17
187 0.17
188 0.17
189 0.17
190 0.17
191 0.19
192 0.21
193 0.19
194 0.16
195 0.18
196 0.19
197 0.22
198 0.27
199 0.22
200 0.21
201 0.26
202 0.32
203 0.32
204 0.36
205 0.36
206 0.36
207 0.38
208 0.38
209 0.38
210 0.36
211 0.35
212 0.31
213 0.33
214 0.34
215 0.39
216 0.49
217 0.55
218 0.62
219 0.72
220 0.81
221 0.86
222 0.91
223 0.93
224 0.92
225 0.92
226 0.87
227 0.84
228 0.77
229 0.74
230 0.71
231 0.65
232 0.63
233 0.61
234 0.62
235 0.63
236 0.64
237 0.64
238 0.65
239 0.64