Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4VT41

Protein Details
Accession A0A4Q4VT41    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
56-75DYTVVTEGSKNKKKKKDDKKBasic
NLS Segment(s)
PositionSequence
65-75KNKKKKKDDKK
Subcellular Location(s) nucl 17.5, cyto_nucl 10.833, mito_nucl 10.833
Family & Domain DBs
Amino Acid Sequences MSSTSGDKGGDKAAGDKSQEQPDYAIRQQFDPVPDQVKGPFDPPNYNPATAHRSGDYTVVTEGSKNKKKKKDDKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.23
3 0.26
4 0.29
5 0.34
6 0.34
7 0.31
8 0.28
9 0.29
10 0.33
11 0.32
12 0.3
13 0.24
14 0.24
15 0.25
16 0.26
17 0.23
18 0.2
19 0.19
20 0.18
21 0.17
22 0.17
23 0.17
24 0.17
25 0.15
26 0.15
27 0.17
28 0.16
29 0.2
30 0.2
31 0.26
32 0.26
33 0.26
34 0.25
35 0.25
36 0.29
37 0.27
38 0.28
39 0.22
40 0.21
41 0.21
42 0.23
43 0.19
44 0.14
45 0.13
46 0.13
47 0.12
48 0.13
49 0.19
50 0.27
51 0.35
52 0.43
53 0.52
54 0.6
55 0.71