Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q4UY51

Protein Details
Accession A0A4Q4UY51    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
12-37HEKATKKSGKRSGKSTKKGKKTQDADBasic
NLS Segment(s)
PositionSequence
10-32KGHEKATKKSGKRSGKSTKKGKK
Subcellular Location(s) mito 15, nucl 8, cyto 2
Family & Domain DBs
Amino Acid Sequences MDHAGSTSAKGHEKATKKSGKRSGKSTKKGKKTQDADLVAVGSQFWPAHGTEPSSKDEEYPSQLDLDSKDH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.46
3 0.52
4 0.54
5 0.62
6 0.69
7 0.71
8 0.7
9 0.73
10 0.74
11 0.76
12 0.81
13 0.82
14 0.81
15 0.81
16 0.84
17 0.82
18 0.81
19 0.75
20 0.73
21 0.71
22 0.63
23 0.54
24 0.46
25 0.38
26 0.28
27 0.23
28 0.16
29 0.07
30 0.06
31 0.05
32 0.05
33 0.06
34 0.06
35 0.09
36 0.1
37 0.13
38 0.17
39 0.2
40 0.23
41 0.25
42 0.25
43 0.23
44 0.26
45 0.27
46 0.27
47 0.26
48 0.24
49 0.22
50 0.23
51 0.23