Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4W107

Protein Details
Accession A0A4Q4W107    Localization Confidence High Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
156-179LSRTGRSSVSRHRRPRRHGSPAWLHydrophilic
NLS Segment(s)
PositionSequence
166-174RHRRPRRHG
Subcellular Location(s) nucl 23, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR008922  Di-copper_centre_dom_sf  
IPR002227  Tyrosinase_Cu-bd  
Gene Ontology GO:0016491  F:oxidoreductase activity  
Pfam View protein in Pfam  
PF00264  Tyrosinase  
Amino Acid Sequences MENEPAGPELAKGWFDNLLPGLPRGRRLPRNYSTEPPKRTGQTVMQRKELSSLQASRYAVGEVRPATTAVPTSPSSTLRSLLTSMCPAPSGPRTANFCPYMGQPLHECGYLSRLVLPYWDWPAYIGKPLNGSTTFDGGPSSLSGEGGADGQRAGLLSRTGRSSVSRHRRPRRHGSPAWLWRQMRSRRLIEPTTRSFTRNLNEVAEQVTANAEPVNVLLTALDITDFQAQFGPIHSEGHIVSGP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.17
4 0.16
5 0.17
6 0.16
7 0.18
8 0.23
9 0.22
10 0.27
11 0.31
12 0.4
13 0.46
14 0.52
15 0.6
16 0.61
17 0.68
18 0.7
19 0.72
20 0.73
21 0.73
22 0.71
23 0.66
24 0.65
25 0.59
26 0.56
27 0.52
28 0.51
29 0.52
30 0.57
31 0.57
32 0.58
33 0.56
34 0.53
35 0.52
36 0.44
37 0.37
38 0.32
39 0.31
40 0.27
41 0.31
42 0.31
43 0.28
44 0.27
45 0.24
46 0.19
47 0.16
48 0.18
49 0.13
50 0.14
51 0.14
52 0.13
53 0.13
54 0.13
55 0.13
56 0.09
57 0.12
58 0.12
59 0.14
60 0.16
61 0.17
62 0.19
63 0.2
64 0.21
65 0.18
66 0.18
67 0.17
68 0.16
69 0.16
70 0.15
71 0.14
72 0.12
73 0.12
74 0.11
75 0.13
76 0.14
77 0.17
78 0.15
79 0.19
80 0.25
81 0.27
82 0.32
83 0.3
84 0.28
85 0.25
86 0.25
87 0.26
88 0.2
89 0.19
90 0.15
91 0.16
92 0.17
93 0.16
94 0.15
95 0.1
96 0.12
97 0.11
98 0.11
99 0.1
100 0.09
101 0.09
102 0.09
103 0.1
104 0.09
105 0.11
106 0.11
107 0.1
108 0.1
109 0.12
110 0.12
111 0.15
112 0.14
113 0.12
114 0.13
115 0.14
116 0.16
117 0.14
118 0.16
119 0.13
120 0.15
121 0.14
122 0.13
123 0.12
124 0.1
125 0.09
126 0.08
127 0.07
128 0.05
129 0.05
130 0.05
131 0.05
132 0.05
133 0.06
134 0.06
135 0.05
136 0.04
137 0.04
138 0.04
139 0.04
140 0.04
141 0.05
142 0.06
143 0.07
144 0.09
145 0.1
146 0.11
147 0.12
148 0.14
149 0.18
150 0.27
151 0.37
152 0.46
153 0.55
154 0.66
155 0.74
156 0.8
157 0.86
158 0.86
159 0.85
160 0.8
161 0.78
162 0.78
163 0.77
164 0.75
165 0.72
166 0.63
167 0.58
168 0.62
169 0.62
170 0.58
171 0.56
172 0.54
173 0.52
174 0.58
175 0.59
176 0.57
177 0.58
178 0.57
179 0.57
180 0.54
181 0.5
182 0.45
183 0.44
184 0.41
185 0.38
186 0.34
187 0.3
188 0.3
189 0.29
190 0.28
191 0.24
192 0.2
193 0.14
194 0.14
195 0.1
196 0.1
197 0.09
198 0.07
199 0.06
200 0.06
201 0.07
202 0.06
203 0.06
204 0.05
205 0.06
206 0.06
207 0.06
208 0.06
209 0.05
210 0.07
211 0.13
212 0.13
213 0.13
214 0.14
215 0.15
216 0.15
217 0.17
218 0.21
219 0.16
220 0.18
221 0.18
222 0.18
223 0.17