Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4VL80

Protein Details
Accession A0A4Q4VL80   
Localization Confidence Low
Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
258-278RNEKMHPTPGSARKRPRHSQVBasic
NLS Segment(s)
PositionSequence
255-274KRERNEKMHPTPGSARKRPR
Subcellular Location(s) cyto 16, cyto_nucl 12, nucl 6, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR011333  SKP1/BTB/POZ_sf  
CDD cd18186  BTB_POZ_ZBTB_KLHL-like  
Amino Acid Sequences MAEEFNEAAHVEEHAANPGGDVEMAEGEPAADNGVSAGELPFAEGGEADPRPTFVSYLTSPVVTLIVGSGDNETILTAHQGLLVQSPFFAEACAAFTNDGSPRQIELASDETDAVGCFLEFLYTGDYFPKKLPGQRSLEPDPSLPEVDETGEQLLKHARVYTLAEKFGVDKLKSLAISKIHCVNSTAKGEITYARYVYQYTRKDDTTVRAPVANFWATRSHTLRAEAEEEFRGLCLEFPQFGYDVLTRVLDEKLKRERNEKMHPTPGSARKRPRHSQV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.16
3 0.14
4 0.14
5 0.14
6 0.12
7 0.1
8 0.09
9 0.07
10 0.07
11 0.07
12 0.07
13 0.06
14 0.06
15 0.06
16 0.06
17 0.06
18 0.05
19 0.04
20 0.05
21 0.05
22 0.05
23 0.05
24 0.05
25 0.05
26 0.05
27 0.06
28 0.06
29 0.06
30 0.06
31 0.05
32 0.06
33 0.09
34 0.1
35 0.1
36 0.1
37 0.11
38 0.13
39 0.14
40 0.13
41 0.1
42 0.15
43 0.15
44 0.19
45 0.19
46 0.17
47 0.16
48 0.16
49 0.16
50 0.1
51 0.09
52 0.05
53 0.05
54 0.05
55 0.05
56 0.05
57 0.05
58 0.05
59 0.05
60 0.05
61 0.04
62 0.05
63 0.05
64 0.05
65 0.05
66 0.06
67 0.06
68 0.07
69 0.09
70 0.09
71 0.08
72 0.08
73 0.08
74 0.08
75 0.07
76 0.07
77 0.05
78 0.05
79 0.07
80 0.08
81 0.08
82 0.07
83 0.07
84 0.09
85 0.11
86 0.12
87 0.1
88 0.1
89 0.11
90 0.11
91 0.12
92 0.1
93 0.11
94 0.12
95 0.13
96 0.12
97 0.12
98 0.11
99 0.11
100 0.1
101 0.08
102 0.05
103 0.03
104 0.03
105 0.03
106 0.03
107 0.03
108 0.04
109 0.06
110 0.06
111 0.07
112 0.09
113 0.09
114 0.1
115 0.11
116 0.16
117 0.15
118 0.19
119 0.25
120 0.29
121 0.35
122 0.38
123 0.44
124 0.43
125 0.45
126 0.41
127 0.36
128 0.31
129 0.27
130 0.23
131 0.16
132 0.12
133 0.09
134 0.09
135 0.09
136 0.07
137 0.07
138 0.07
139 0.07
140 0.07
141 0.09
142 0.09
143 0.09
144 0.09
145 0.09
146 0.09
147 0.13
148 0.18
149 0.19
150 0.19
151 0.19
152 0.18
153 0.19
154 0.21
155 0.22
156 0.16
157 0.14
158 0.15
159 0.17
160 0.18
161 0.18
162 0.18
163 0.17
164 0.19
165 0.2
166 0.26
167 0.25
168 0.25
169 0.26
170 0.25
171 0.27
172 0.28
173 0.27
174 0.2
175 0.2
176 0.2
177 0.2
178 0.21
179 0.17
180 0.15
181 0.15
182 0.15
183 0.16
184 0.19
185 0.26
186 0.27
187 0.31
188 0.34
189 0.34
190 0.36
191 0.38
192 0.4
193 0.38
194 0.37
195 0.33
196 0.32
197 0.31
198 0.3
199 0.32
200 0.29
201 0.22
202 0.2
203 0.23
204 0.23
205 0.29
206 0.3
207 0.29
208 0.29
209 0.32
210 0.32
211 0.3
212 0.31
213 0.26
214 0.26
215 0.23
216 0.21
217 0.18
218 0.16
219 0.14
220 0.11
221 0.1
222 0.09
223 0.1
224 0.11
225 0.12
226 0.13
227 0.13
228 0.13
229 0.16
230 0.15
231 0.14
232 0.14
233 0.14
234 0.12
235 0.14
236 0.16
237 0.18
238 0.19
239 0.26
240 0.35
241 0.44
242 0.48
243 0.53
244 0.6
245 0.64
246 0.73
247 0.75
248 0.73
249 0.74
250 0.71
251 0.71
252 0.71
253 0.71
254 0.7
255 0.7
256 0.72
257 0.72
258 0.81