Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4ULH4

Protein Details
Accession A0A4Q4ULH4   
Localization Confidence Medium
Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
285-322EKPTAAELRRMKRKRAKQSKKDKRKFQPEPKEDLRKRTBasic
NLS Segment(s)
PositionSequence
292-320LRRMKRKRAKQSKKDKRKFQPEPKEDLRK
Subcellular Location(s) nucl 21.5, cyto_nucl 13.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR024526  DUF3807  
Pfam View protein in Pfam  
PF12720  DUF3807  
Amino Acid Sequences MVEPPTQVMEEQSDSEEESPQQTQVLRFDPSQGPPADSAHEHHYQTRTPELQKRQSQKVEVQRSPNPEGHLAPFDWDEFEARYEKALNEADEREKELLDEFDRLVKYFNAWASASSAHDNERAVKRLQTRERYVRLSERQLMQKKQHRAFQAPEVSQAEIDSFHESHFSNAAVELFKAEFLMPGNAPDNEHFYDEHYHDGYDEEEDDGLGYYPDGVKRTLTDEQIAIFRHSEIESLRRAQSKVDQAKAESAAMLQASRVDDQTAVAEDDDGELGAASEDGELESEKPTAAELRRMKRKRAKQSKKDKRKFQPEPKEDLRKRTWDKVEAGMDSLDYDGLETAHDATSIHTAQRRRISYED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.19
4 0.17
5 0.18
6 0.18
7 0.16
8 0.18
9 0.19
10 0.21
11 0.24
12 0.26
13 0.26
14 0.25
15 0.31
16 0.33
17 0.33
18 0.38
19 0.34
20 0.33
21 0.31
22 0.32
23 0.29
24 0.26
25 0.26
26 0.25
27 0.29
28 0.29
29 0.32
30 0.34
31 0.34
32 0.36
33 0.4
34 0.41
35 0.43
36 0.5
37 0.55
38 0.61
39 0.67
40 0.71
41 0.73
42 0.74
43 0.72
44 0.72
45 0.73
46 0.73
47 0.7
48 0.7
49 0.66
50 0.66
51 0.66
52 0.6
53 0.53
54 0.45
55 0.42
56 0.37
57 0.35
58 0.28
59 0.25
60 0.22
61 0.2
62 0.17
63 0.16
64 0.14
65 0.11
66 0.13
67 0.13
68 0.12
69 0.13
70 0.14
71 0.13
72 0.17
73 0.18
74 0.18
75 0.19
76 0.22
77 0.25
78 0.25
79 0.27
80 0.23
81 0.21
82 0.2
83 0.18
84 0.17
85 0.14
86 0.15
87 0.12
88 0.16
89 0.17
90 0.17
91 0.17
92 0.15
93 0.15
94 0.16
95 0.16
96 0.15
97 0.15
98 0.15
99 0.16
100 0.16
101 0.16
102 0.15
103 0.15
104 0.14
105 0.15
106 0.15
107 0.19
108 0.21
109 0.23
110 0.23
111 0.26
112 0.31
113 0.39
114 0.47
115 0.49
116 0.53
117 0.58
118 0.62
119 0.62
120 0.59
121 0.57
122 0.54
123 0.52
124 0.49
125 0.46
126 0.49
127 0.52
128 0.54
129 0.55
130 0.58
131 0.61
132 0.61
133 0.61
134 0.57
135 0.55
136 0.52
137 0.52
138 0.51
139 0.42
140 0.41
141 0.37
142 0.33
143 0.28
144 0.25
145 0.17
146 0.1
147 0.11
148 0.09
149 0.08
150 0.08
151 0.1
152 0.1
153 0.1
154 0.1
155 0.1
156 0.07
157 0.07
158 0.08
159 0.07
160 0.06
161 0.07
162 0.06
163 0.05
164 0.06
165 0.05
166 0.05
167 0.05
168 0.07
169 0.06
170 0.07
171 0.09
172 0.08
173 0.09
174 0.09
175 0.13
176 0.12
177 0.13
178 0.12
179 0.13
180 0.16
181 0.16
182 0.17
183 0.14
184 0.13
185 0.12
186 0.12
187 0.11
188 0.08
189 0.08
190 0.06
191 0.06
192 0.05
193 0.05
194 0.05
195 0.05
196 0.04
197 0.03
198 0.03
199 0.05
200 0.06
201 0.07
202 0.07
203 0.08
204 0.09
205 0.14
206 0.17
207 0.17
208 0.17
209 0.16
210 0.17
211 0.19
212 0.2
213 0.16
214 0.13
215 0.12
216 0.12
217 0.12
218 0.12
219 0.11
220 0.13
221 0.15
222 0.17
223 0.2
224 0.22
225 0.23
226 0.23
227 0.29
228 0.35
229 0.39
230 0.41
231 0.39
232 0.37
233 0.39
234 0.39
235 0.32
236 0.22
237 0.16
238 0.12
239 0.11
240 0.1
241 0.06
242 0.07
243 0.08
244 0.09
245 0.1
246 0.09
247 0.09
248 0.1
249 0.11
250 0.1
251 0.09
252 0.08
253 0.08
254 0.07
255 0.08
256 0.07
257 0.06
258 0.05
259 0.04
260 0.04
261 0.04
262 0.04
263 0.03
264 0.03
265 0.03
266 0.03
267 0.04
268 0.05
269 0.05
270 0.07
271 0.07
272 0.07
273 0.07
274 0.08
275 0.13
276 0.14
277 0.22
278 0.3
279 0.39
280 0.5
281 0.55
282 0.64
283 0.69
284 0.78
285 0.8
286 0.84
287 0.86
288 0.86
289 0.93
290 0.94
291 0.95
292 0.95
293 0.95
294 0.94
295 0.94
296 0.95
297 0.94
298 0.94
299 0.9
300 0.89
301 0.88
302 0.88
303 0.82
304 0.8
305 0.76
306 0.75
307 0.74
308 0.74
309 0.72
310 0.68
311 0.67
312 0.66
313 0.64
314 0.54
315 0.49
316 0.39
317 0.32
318 0.25
319 0.22
320 0.14
321 0.08
322 0.08
323 0.06
324 0.06
325 0.06
326 0.06
327 0.08
328 0.08
329 0.08
330 0.08
331 0.09
332 0.14
333 0.15
334 0.19
335 0.23
336 0.26
337 0.34
338 0.43
339 0.45