Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4VPG3

Protein Details
Accession A0A4Q4VPG3   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
76-95GPLRSPTDRRHVKRIRRVGTBasic
NLS Segment(s)
PositionSequence
55-108ARAGARLTRSRLRTREPGPGPGPLRSPTDRRHVKRIRRVGTGPRGGRRAVVERR
Subcellular Location(s) mito 25
Family & Domain DBs
Amino Acid Sequences MPSARPATPAPRRNSRSAALGPRVYPVSLHPVVRVPDAEHTHVPPATAQHAPPGARAGARLTRSRLRTREPGPGPGPLRSPTDRRHVKRIRRVGTGPRGGRRAVVERREGLRQQRVPLAAAAD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.61
3 0.58
4 0.57
5 0.58
6 0.54
7 0.51
8 0.45
9 0.43
10 0.41
11 0.34
12 0.27
13 0.21
14 0.22
15 0.22
16 0.22
17 0.2
18 0.23
19 0.24
20 0.25
21 0.24
22 0.17
23 0.21
24 0.24
25 0.26
26 0.23
27 0.23
28 0.25
29 0.24
30 0.23
31 0.17
32 0.15
33 0.15
34 0.15
35 0.13
36 0.13
37 0.16
38 0.16
39 0.16
40 0.16
41 0.13
42 0.12
43 0.13
44 0.12
45 0.14
46 0.16
47 0.18
48 0.2
49 0.25
50 0.29
51 0.35
52 0.36
53 0.37
54 0.42
55 0.43
56 0.49
57 0.46
58 0.48
59 0.43
60 0.46
61 0.43
62 0.37
63 0.36
64 0.29
65 0.31
66 0.28
67 0.31
68 0.29
69 0.38
70 0.46
71 0.48
72 0.57
73 0.61
74 0.68
75 0.74
76 0.8
77 0.76
78 0.72
79 0.73
80 0.72
81 0.73
82 0.72
83 0.67
84 0.63
85 0.6
86 0.54
87 0.51
88 0.46
89 0.45
90 0.44
91 0.44
92 0.43
93 0.46
94 0.49
95 0.53
96 0.54
97 0.54
98 0.55
99 0.54
100 0.53
101 0.54
102 0.52
103 0.47