Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q4VX68

Protein Details
Accession A0A4Q4VX68    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
60-83PIDYRVPKASRNRLNKAKKISNKFHydrophilic
NLS Segment(s)
PositionSequence
75-78KAKK
Subcellular Location(s) mito 10, pero 6, cyto 5.5, cyto_nucl 4, extr 3
Family & Domain DBs
Amino Acid Sequences MAEPSSDFGARLVAYLVGYSAPEIFSDPWRIYGPWAPAFVGSLTGCICYDSMIFFGSESPIDYRVPKASRNRLNKAKKISNKF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.08
4 0.06
5 0.06
6 0.06
7 0.06
8 0.05
9 0.05
10 0.07
11 0.08
12 0.1
13 0.14
14 0.14
15 0.16
16 0.17
17 0.17
18 0.17
19 0.2
20 0.23
21 0.21
22 0.21
23 0.19
24 0.18
25 0.18
26 0.16
27 0.13
28 0.09
29 0.07
30 0.07
31 0.07
32 0.07
33 0.07
34 0.07
35 0.05
36 0.05
37 0.05
38 0.06
39 0.06
40 0.06
41 0.05
42 0.06
43 0.06
44 0.06
45 0.07
46 0.08
47 0.09
48 0.1
49 0.12
50 0.14
51 0.2
52 0.22
53 0.28
54 0.37
55 0.45
56 0.54
57 0.63
58 0.7
59 0.74
60 0.82
61 0.83
62 0.84
63 0.84