Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4VHE9

Protein Details
Accession A0A4Q4VHE9   
Localization Confidence High
Confidence Score 17
NoLS Segment(s)
PositionSequenceProtein Nature
16-39VLKSDRVVFRSRRKRPAVRREGDGBasic
59-81LKPDRMVLRSRRKRPAVRRKGDGBasic
182-202GRVPKPDRMVPRSRHKRPAVRBasic
NLS Segment(s)
PositionSequence
21-35RVVFRSRRKRPAVRR
59-80LKPDRMVLRSRRKRPAVRRKGD
111-114RRKR
152-161SRHKRPAVRR
173-202LKRLPVRAAGRVPKPDRMVPRSRHKRPAVR
Subcellular Location(s) mito 25
Family & Domain DBs
Amino Acid Sequences MAVPLKRLPVRAAGRVLKSDRVVFRSRRKRPAVRREGDGINGTVMLFERLPVRAAGRVLKPDRMVLRSRRKRPAVRRKGDGGDRMAVPLERLPVRAVSRVLQPDRLVFRSRRKRPAVPRQGDGVNGTAVPLERLPVRAVSRVLKLDHMVPRSRHKRPAVRREGDGVNVIAVPLKRLPVRAAGRVPKPDRMVPRSRHKRPAVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.52
3 0.53
4 0.49
5 0.46
6 0.47
7 0.44
8 0.43
9 0.47
10 0.49
11 0.57
12 0.62
13 0.69
14 0.72
15 0.77
16 0.82
17 0.86
18 0.89
19 0.89
20 0.83
21 0.79
22 0.75
23 0.68
24 0.6
25 0.52
26 0.41
27 0.3
28 0.25
29 0.19
30 0.14
31 0.12
32 0.09
33 0.07
34 0.07
35 0.08
36 0.08
37 0.1
38 0.1
39 0.11
40 0.12
41 0.14
42 0.18
43 0.19
44 0.27
45 0.28
46 0.31
47 0.3
48 0.33
49 0.34
50 0.33
51 0.37
52 0.38
53 0.47
54 0.54
55 0.61
56 0.66
57 0.71
58 0.77
59 0.83
60 0.84
61 0.84
62 0.81
63 0.79
64 0.75
65 0.73
66 0.68
67 0.61
68 0.52
69 0.44
70 0.37
71 0.31
72 0.26
73 0.2
74 0.15
75 0.11
76 0.11
77 0.09
78 0.1
79 0.1
80 0.12
81 0.14
82 0.15
83 0.15
84 0.14
85 0.18
86 0.22
87 0.22
88 0.21
89 0.21
90 0.22
91 0.24
92 0.25
93 0.24
94 0.23
95 0.33
96 0.41
97 0.48
98 0.55
99 0.58
100 0.64
101 0.71
102 0.79
103 0.79
104 0.73
105 0.68
106 0.62
107 0.57
108 0.49
109 0.4
110 0.3
111 0.19
112 0.14
113 0.12
114 0.08
115 0.07
116 0.07
117 0.06
118 0.06
119 0.06
120 0.08
121 0.08
122 0.11
123 0.12
124 0.13
125 0.16
126 0.18
127 0.21
128 0.22
129 0.23
130 0.21
131 0.21
132 0.25
133 0.28
134 0.3
135 0.32
136 0.32
137 0.42
138 0.49
139 0.54
140 0.57
141 0.6
142 0.66
143 0.72
144 0.79
145 0.8
146 0.76
147 0.73
148 0.7
149 0.63
150 0.55
151 0.47
152 0.36
153 0.25
154 0.21
155 0.17
156 0.15
157 0.12
158 0.12
159 0.11
160 0.15
161 0.15
162 0.17
163 0.2
164 0.26
165 0.32
166 0.37
167 0.44
168 0.48
169 0.54
170 0.62
171 0.64
172 0.61
173 0.61
174 0.61
175 0.63
176 0.62
177 0.65
178 0.64
179 0.72
180 0.76
181 0.8
182 0.83