Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4VJF0

Protein Details
Accession A0A4Q4VJF0    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
90-127YQRFHERPGLKRKRLKSERWQKRFKRGFKETVRRVRELBasic
NLS Segment(s)
PositionSequence
96-123RPGLKRKRLKSERWQKRFKRGFKETVRR
Subcellular Location(s) nucl 18.5, cyto_nucl 14.5, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001911  Ribosomal_S21  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01165  Ribosomal_S21  
Amino Acid Sequences MSQYYGPDPSESGSGEPTYDSVSQDVYIELSDLQKTKHSETGPEAPKPTMRLVPRLGRTVHVSSHVDVARSFKILAIQVAQNRIRQEFQYQRFHERPGLKRKRLKSERWQKRFKRGFKETVRRVRELTRQGW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.14
3 0.14
4 0.13
5 0.14
6 0.14
7 0.14
8 0.12
9 0.12
10 0.12
11 0.12
12 0.12
13 0.09
14 0.08
15 0.07
16 0.07
17 0.08
18 0.09
19 0.1
20 0.1
21 0.15
22 0.17
23 0.2
24 0.25
25 0.24
26 0.26
27 0.3
28 0.39
29 0.39
30 0.39
31 0.38
32 0.33
33 0.34
34 0.33
35 0.3
36 0.26
37 0.23
38 0.25
39 0.28
40 0.34
41 0.36
42 0.37
43 0.35
44 0.31
45 0.34
46 0.3
47 0.26
48 0.23
49 0.22
50 0.19
51 0.23
52 0.21
53 0.17
54 0.16
55 0.18
56 0.14
57 0.14
58 0.13
59 0.09
60 0.1
61 0.1
62 0.11
63 0.1
64 0.12
65 0.13
66 0.19
67 0.2
68 0.21
69 0.22
70 0.23
71 0.22
72 0.21
73 0.27
74 0.31
75 0.36
76 0.43
77 0.45
78 0.51
79 0.52
80 0.53
81 0.53
82 0.52
83 0.54
84 0.55
85 0.63
86 0.64
87 0.7
88 0.76
89 0.8
90 0.81
91 0.82
92 0.82
93 0.82
94 0.85
95 0.86
96 0.89
97 0.86
98 0.88
99 0.89
100 0.86
101 0.86
102 0.83
103 0.84
104 0.84
105 0.87
106 0.86
107 0.87
108 0.84
109 0.77
110 0.72
111 0.69
112 0.67