Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4VUA1

Protein Details
Accession A0A4Q4VUA1   
Localization Confidence High
Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
97-121RIDKDKTDKNDKGKKHKGFLGRLKKBasic
NLS Segment(s)
PositionSequence
5-22RKVKGKGKEKGKNTAPPK
65-121DKEDKDKKEKNKKDMGEKDKDKRDKNDNGKKDRIDKDKTDKNDKGKKHKGFLGRLKK
Subcellular Location(s) nucl 15, mito 11
Family & Domain DBs
Amino Acid Sequences MSDNRKVKGKGKEKGKNTAPPKPQATSGQTATLAAGPRRRSAVPAELRPPFSGREADFSVPDGKDKEDKDKKEKNKKDMGEKDKDKRDKNDNGKKDRIDKDKTDKNDKGKKHKGFLGRLKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.79
3 0.78
4 0.75
5 0.76
6 0.72
7 0.71
8 0.7
9 0.62
10 0.58
11 0.55
12 0.53
13 0.49
14 0.44
15 0.38
16 0.33
17 0.31
18 0.27
19 0.23
20 0.2
21 0.17
22 0.2
23 0.19
24 0.2
25 0.23
26 0.23
27 0.22
28 0.24
29 0.3
30 0.32
31 0.35
32 0.39
33 0.39
34 0.4
35 0.39
36 0.37
37 0.29
38 0.24
39 0.22
40 0.17
41 0.19
42 0.19
43 0.19
44 0.18
45 0.18
46 0.19
47 0.16
48 0.16
49 0.13
50 0.12
51 0.15
52 0.16
53 0.25
54 0.3
55 0.36
56 0.44
57 0.52
58 0.62
59 0.69
60 0.75
61 0.73
62 0.75
63 0.75
64 0.76
65 0.77
66 0.75
67 0.74
68 0.74
69 0.75
70 0.75
71 0.78
72 0.73
73 0.7
74 0.71
75 0.71
76 0.74
77 0.76
78 0.76
79 0.76
80 0.78
81 0.76
82 0.76
83 0.75
84 0.72
85 0.69
86 0.67
87 0.69
88 0.7
89 0.73
90 0.74
91 0.72
92 0.74
93 0.76
94 0.77
95 0.78
96 0.8
97 0.8
98 0.78
99 0.78
100 0.77
101 0.78