Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G9MM79

Protein Details
Accession G9MM79   
Localization Confidence High
Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
119-159GHRHHHGRGKRTNGKKRAPSPNAYEKIPKPKPKDTGKEVPKBasic
NLS Segment(s)
PositionSequence
100-105RRKKKA
119-159GHRHHHGRGKRTNGKKRAPSPNAYEKIPKPKPKDTGKEVPK
Subcellular Location(s) nucl 22.5, cyto_nucl 14, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011107  PPI_Ypi1  
Gene Ontology GO:0005634  C:nucleus  
GO:0004865  F:protein serine/threonine phosphatase inhibitor activity  
GO:0032515  P:negative regulation of phosphoprotein phosphatase activity  
Pfam View protein in Pfam  
PF07491  PPI_Ypi1  
Amino Acid Sequences MSQQQERSAQPPTASQTTTDTIQSETEEGSPRVILRLRGGHTSNGRSVQWAEDVVDNEGLGRKSSKVCCIYHRPKGVDESSDESSSDSSSSDSDSDAEPRRKKKASGDKDDCGHSHEHGHRHHHGRGKRTNGKKRAPSPNAYEKIPKPKPKDTGKEVPK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.31
3 0.3
4 0.3
5 0.31
6 0.28
7 0.22
8 0.19
9 0.19
10 0.19
11 0.15
12 0.13
13 0.14
14 0.16
15 0.16
16 0.15
17 0.15
18 0.14
19 0.17
20 0.18
21 0.17
22 0.18
23 0.23
24 0.24
25 0.29
26 0.31
27 0.33
28 0.35
29 0.37
30 0.36
31 0.33
32 0.31
33 0.28
34 0.27
35 0.22
36 0.19
37 0.16
38 0.14
39 0.13
40 0.14
41 0.13
42 0.13
43 0.11
44 0.1
45 0.12
46 0.11
47 0.09
48 0.09
49 0.09
50 0.13
51 0.15
52 0.22
53 0.24
54 0.26
55 0.31
56 0.41
57 0.47
58 0.51
59 0.55
60 0.5
61 0.47
62 0.49
63 0.45
64 0.36
65 0.3
66 0.27
67 0.23
68 0.21
69 0.2
70 0.16
71 0.15
72 0.13
73 0.11
74 0.07
75 0.06
76 0.05
77 0.06
78 0.06
79 0.06
80 0.07
81 0.07
82 0.12
83 0.18
84 0.25
85 0.3
86 0.34
87 0.4
88 0.42
89 0.44
90 0.5
91 0.55
92 0.58
93 0.64
94 0.67
95 0.65
96 0.65
97 0.65
98 0.55
99 0.46
100 0.37
101 0.27
102 0.28
103 0.28
104 0.32
105 0.34
106 0.4
107 0.46
108 0.5
109 0.55
110 0.55
111 0.56
112 0.58
113 0.62
114 0.66
115 0.68
116 0.73
117 0.78
118 0.8
119 0.84
120 0.85
121 0.86
122 0.87
123 0.84
124 0.8
125 0.78
126 0.79
127 0.73
128 0.67
129 0.65
130 0.6
131 0.65
132 0.67
133 0.68
134 0.65
135 0.7
136 0.76
137 0.78
138 0.81
139 0.79