Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q4VT14

Protein Details
Accession A0A4Q4VT14    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
158-177SAITSTTKGGRKKRKKDGGKBasic
NLS Segment(s)
PositionSequence
165-177KGGRKKRKKDGGK
Subcellular Location(s) cyto 16.5, cyto_nucl 12, nucl 6.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR003195  TFIID_TAF13  
Gene Ontology GO:0005634  C:nucleus  
GO:0046982  F:protein heterodimerization activity  
GO:0006366  P:transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF02269  TFIID-18kDa  
Amino Acid Sequences MEPRARAGKNVGKETFQPKDVSRLLFAFGDVESPLPETVRVLDEIVTEFLEGVCFEASRHAQAAGRQKLKFDDFEFALRRSPAYLGKVRSMIDKRQHIASMRNLFKENDDDLINTRDHGHSHHAGARGGAGGGADNKRAAPPEEELLGLSDDDGEVLSAITSTTKGGRKKRKKDGGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.52
3 0.47
4 0.43
5 0.36
6 0.42
7 0.43
8 0.4
9 0.35
10 0.31
11 0.3
12 0.27
13 0.26
14 0.18
15 0.14
16 0.13
17 0.1
18 0.1
19 0.07
20 0.09
21 0.09
22 0.08
23 0.08
24 0.08
25 0.09
26 0.1
27 0.11
28 0.1
29 0.1
30 0.1
31 0.11
32 0.12
33 0.1
34 0.08
35 0.08
36 0.07
37 0.07
38 0.06
39 0.05
40 0.05
41 0.05
42 0.05
43 0.09
44 0.09
45 0.1
46 0.11
47 0.11
48 0.12
49 0.17
50 0.27
51 0.31
52 0.36
53 0.35
54 0.36
55 0.38
56 0.38
57 0.36
58 0.28
59 0.24
60 0.19
61 0.24
62 0.25
63 0.22
64 0.22
65 0.2
66 0.18
67 0.15
68 0.16
69 0.14
70 0.16
71 0.2
72 0.2
73 0.21
74 0.23
75 0.22
76 0.27
77 0.27
78 0.28
79 0.31
80 0.33
81 0.33
82 0.33
83 0.35
84 0.31
85 0.32
86 0.34
87 0.36
88 0.34
89 0.35
90 0.34
91 0.33
92 0.32
93 0.31
94 0.25
95 0.18
96 0.16
97 0.14
98 0.15
99 0.17
100 0.16
101 0.13
102 0.14
103 0.12
104 0.12
105 0.14
106 0.17
107 0.17
108 0.2
109 0.23
110 0.24
111 0.24
112 0.23
113 0.22
114 0.16
115 0.14
116 0.11
117 0.07
118 0.05
119 0.09
120 0.09
121 0.1
122 0.1
123 0.1
124 0.11
125 0.13
126 0.15
127 0.14
128 0.16
129 0.18
130 0.19
131 0.19
132 0.18
133 0.17
134 0.16
135 0.13
136 0.1
137 0.07
138 0.06
139 0.06
140 0.06
141 0.04
142 0.04
143 0.04
144 0.04
145 0.04
146 0.04
147 0.04
148 0.05
149 0.06
150 0.12
151 0.18
152 0.26
153 0.37
154 0.48
155 0.59
156 0.69
157 0.79