Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G9MVM2

Protein Details
Accession G9MVM2    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
86-110QPEDRQRRGRSRNPRERNRQKSTSTHydrophilic
NLS Segment(s)
PositionSequence
92-103RRGRSRNPRERN
Subcellular Location(s) mito 13.5, cyto_mito 9.333, nucl 8.5, cyto_nucl 6.833, cyto 4
Family & Domain DBs
Amino Acid Sequences MSSSSSTSASSTNSSSSQGSSKSKWDTEYIDIPREKGLPLRFIAYAAGASLPTTMKKMTRKEKKGGEGASRWDFLGRDTQLFWVVQPEDRQRRGRSRNPRERNRQKSTSTASSPASSPEINVAPGQFGEPAGYFPHPTASGAAGVPMVPPGHGPPRGSGFSFGFPPGTNFPGGPLPPFGRN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.2
4 0.22
5 0.24
6 0.28
7 0.28
8 0.33
9 0.37
10 0.38
11 0.38
12 0.38
13 0.37
14 0.37
15 0.43
16 0.4
17 0.42
18 0.4
19 0.39
20 0.37
21 0.34
22 0.29
23 0.27
24 0.26
25 0.23
26 0.23
27 0.25
28 0.23
29 0.22
30 0.22
31 0.16
32 0.13
33 0.09
34 0.09
35 0.06
36 0.06
37 0.06
38 0.06
39 0.06
40 0.08
41 0.09
42 0.13
43 0.2
44 0.29
45 0.39
46 0.49
47 0.55
48 0.62
49 0.68
50 0.7
51 0.7
52 0.66
53 0.61
54 0.53
55 0.52
56 0.47
57 0.4
58 0.33
59 0.27
60 0.23
61 0.18
62 0.21
63 0.16
64 0.14
65 0.14
66 0.15
67 0.15
68 0.15
69 0.14
70 0.11
71 0.11
72 0.11
73 0.14
74 0.21
75 0.25
76 0.3
77 0.35
78 0.36
79 0.45
80 0.51
81 0.57
82 0.61
83 0.66
84 0.73
85 0.79
86 0.84
87 0.87
88 0.9
89 0.91
90 0.88
91 0.83
92 0.74
93 0.71
94 0.67
95 0.62
96 0.53
97 0.46
98 0.4
99 0.34
100 0.32
101 0.27
102 0.23
103 0.17
104 0.14
105 0.14
106 0.13
107 0.13
108 0.13
109 0.11
110 0.09
111 0.09
112 0.1
113 0.07
114 0.06
115 0.07
116 0.06
117 0.07
118 0.09
119 0.1
120 0.1
121 0.1
122 0.13
123 0.12
124 0.12
125 0.13
126 0.12
127 0.12
128 0.11
129 0.12
130 0.09
131 0.08
132 0.08
133 0.08
134 0.07
135 0.06
136 0.07
137 0.1
138 0.16
139 0.19
140 0.2
141 0.22
142 0.28
143 0.31
144 0.31
145 0.32
146 0.28
147 0.28
148 0.28
149 0.26
150 0.22
151 0.2
152 0.23
153 0.22
154 0.22
155 0.21
156 0.18
157 0.2
158 0.25
159 0.25
160 0.23
161 0.25