Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q4VTI8

Protein Details
Accession A0A4Q4VTI8    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
57-78EKAAKIREKRFEEYRKKKEAKNBasic
NLS Segment(s)
PositionSequence
59-78AAKIREKRFEEYRKKKEAKN
Subcellular Location(s) cyto 16.5, cyto_nucl 13, nucl 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018940  EF-1_beta_acid_region_euk  
IPR001326  Transl_elong_EF1B_B/D_CS  
Gene Ontology GO:0005853  C:eukaryotic translation elongation factor 1 complex  
GO:0003746  F:translation elongation factor activity  
Pfam View protein in Pfam  
PF10587  EF-1_beta_acid  
PROSITE View protein in PROSITE  
PS00824  EF1BD_1  
Amino Acid Sequences MHFDDNFTTLPGNAAKPYTVYGPEVVAVTLNPAKAPTAEEEDDDIDLFGSGDEKEDEKAAKIREKRFEEYRKKKEAKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.14
4 0.15
5 0.15
6 0.14
7 0.14
8 0.13
9 0.13
10 0.13
11 0.12
12 0.11
13 0.09
14 0.07
15 0.08
16 0.09
17 0.08
18 0.08
19 0.08
20 0.08
21 0.08
22 0.09
23 0.08
24 0.12
25 0.13
26 0.13
27 0.14
28 0.14
29 0.14
30 0.13
31 0.11
32 0.06
33 0.05
34 0.05
35 0.04
36 0.04
37 0.04
38 0.05
39 0.06
40 0.06
41 0.07
42 0.09
43 0.09
44 0.11
45 0.16
46 0.19
47 0.26
48 0.33
49 0.4
50 0.48
51 0.54
52 0.59
53 0.64
54 0.71
55 0.75
56 0.78
57 0.81
58 0.82