Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q4T9W6

Protein Details
Accession A0A4Q4T9W6    Localization Confidence High Confidence Score 17.5
NoLS Segment(s)
PositionSequenceProtein Nature
40-63RLAAAKTAPKNKRKGKQQTVVPEAHydrophilic
NLS Segment(s)
PositionSequence
5-12RTRKPSAK
19-19K
36-55AVSKRLAAAKTAPKNKRKGK
Subcellular Location(s) nucl 20.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
Amino Acid Sequences MAPKRTRKPSAKVANAVEKRRATSSNIRDNNTHRAAVSKRLAAAKTAPKNKRKGKQQTVVPEAEDPEESEIKVVTNTKGDTGSAPEATDNEPSEDEALRNEPSEDEALRNEPSEDEALRNEPFEDKVLRNEPSKAVLSENDAALNKDTSAKTFKPRPLNIRTQFLNIIKVTVNGKPPKEQPNKIRNAI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.77
3 0.73
4 0.7
5 0.62
6 0.56
7 0.52
8 0.48
9 0.43
10 0.46
11 0.51
12 0.54
13 0.57
14 0.57
15 0.58
16 0.6
17 0.63
18 0.56
19 0.47
20 0.36
21 0.36
22 0.36
23 0.4
24 0.39
25 0.32
26 0.32
27 0.35
28 0.35
29 0.31
30 0.36
31 0.37
32 0.42
33 0.49
34 0.54
35 0.57
36 0.67
37 0.74
38 0.77
39 0.78
40 0.8
41 0.81
42 0.81
43 0.81
44 0.81
45 0.78
46 0.7
47 0.6
48 0.5
49 0.41
50 0.33
51 0.26
52 0.16
53 0.13
54 0.12
55 0.11
56 0.1
57 0.09
58 0.08
59 0.09
60 0.1
61 0.08
62 0.1
63 0.1
64 0.11
65 0.11
66 0.11
67 0.11
68 0.12
69 0.13
70 0.11
71 0.11
72 0.1
73 0.11
74 0.11
75 0.12
76 0.1
77 0.09
78 0.09
79 0.09
80 0.1
81 0.09
82 0.08
83 0.07
84 0.09
85 0.08
86 0.08
87 0.08
88 0.07
89 0.08
90 0.1
91 0.09
92 0.08
93 0.09
94 0.1
95 0.11
96 0.11
97 0.1
98 0.08
99 0.09
100 0.1
101 0.09
102 0.08
103 0.09
104 0.11
105 0.11
106 0.11
107 0.11
108 0.1
109 0.11
110 0.12
111 0.15
112 0.14
113 0.19
114 0.23
115 0.25
116 0.26
117 0.27
118 0.26
119 0.26
120 0.27
121 0.23
122 0.2
123 0.19
124 0.22
125 0.21
126 0.2
127 0.19
128 0.17
129 0.18
130 0.17
131 0.17
132 0.12
133 0.16
134 0.15
135 0.16
136 0.21
137 0.23
138 0.3
139 0.37
140 0.44
141 0.5
142 0.57
143 0.62
144 0.65
145 0.73
146 0.7
147 0.7
148 0.65
149 0.59
150 0.59
151 0.52
152 0.5
153 0.39
154 0.35
155 0.28
156 0.29
157 0.27
158 0.24
159 0.31
160 0.32
161 0.35
162 0.39
163 0.46
164 0.54
165 0.61
166 0.67
167 0.69
168 0.73