Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4SXX6

Protein Details
Accession A0A4Q4SXX6    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
18-44NYNKMGHKAYQCKKPKRQQQNTWTPVPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Amino Acid Sequences MEIKAVQQQDRRQIQCYNYNKMGHKAYQCKKPKRQQQNTWTPVPQGPPRNNRSNNKPINIIRVRDDHNPPKEVQQGLQKAKKLSQAAIQEQQTPTTGPTVTQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.58
3 0.58
4 0.56
5 0.53
6 0.56
7 0.55
8 0.55
9 0.54
10 0.49
11 0.51
12 0.53
13 0.54
14 0.58
15 0.66
16 0.71
17 0.77
18 0.81
19 0.83
20 0.85
21 0.88
22 0.89
23 0.89
24 0.9
25 0.85
26 0.8
27 0.7
28 0.61
29 0.52
30 0.46
31 0.41
32 0.37
33 0.39
34 0.43
35 0.47
36 0.54
37 0.6
38 0.6
39 0.63
40 0.65
41 0.64
42 0.58
43 0.58
44 0.5
45 0.53
46 0.52
47 0.45
48 0.38
49 0.36
50 0.38
51 0.37
52 0.44
53 0.43
54 0.43
55 0.44
56 0.42
57 0.43
58 0.45
59 0.4
60 0.36
61 0.36
62 0.4
63 0.46
64 0.5
65 0.49
66 0.46
67 0.48
68 0.52
69 0.45
70 0.39
71 0.38
72 0.4
73 0.43
74 0.47
75 0.46
76 0.44
77 0.43
78 0.42
79 0.36
80 0.29
81 0.24
82 0.2