Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4SZZ6

Protein Details
Accession A0A4Q4SZZ6   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
168-194KAKSNNNREGKRKKKQQPKVRPHPGGDBasic
NLS Segment(s)
PositionSequence
168-189KAKSNNNREGKRKKKQQPKVRP
Subcellular Location(s) nucl 15.5, cyto_nucl 14, cyto 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029001  ITPase-like_fam  
IPR003697  Maf-like  
Gene Ontology GO:0047429  F:nucleoside triphosphate diphosphatase activity  
Pfam View protein in Pfam  
PF02545  Maf  
CDD cd00555  Maf  
Amino Acid Sequences MDEKKPLIPSSDENDNTPADPPPSYVASARGHGIPLRQSATPPIRKGGPPSPPQPLELPIIQYMRSHRVILASASPRRRAMLAQLGLGNLEVRPSTKPEDLSKAELGPHGYVAATARQKALDVYQAVIAELEGAEAGAAGEAAGGAEDGDEEEGDDDDDPTEQGEGGKAKSNNNREGKRKKKQQPKVRPHPGGDPDLVIAADTVIVTRDGQVLEKPTSEAAHVRMLRHLRDTRVHRVLTAVCAVAPRADAAHPGYEMRTHVEETRVWFAREGDGLPDDVLERYARTREGADKAGGYAVQGVGGMLLVEKIDGAVDNVVGLPVRRCLQLCEKVVFRQDEESDEESGEEEGPGGW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.38
3 0.35
4 0.31
5 0.28
6 0.2
7 0.19
8 0.19
9 0.2
10 0.21
11 0.22
12 0.21
13 0.24
14 0.25
15 0.26
16 0.26
17 0.24
18 0.23
19 0.23
20 0.25
21 0.24
22 0.26
23 0.27
24 0.25
25 0.25
26 0.33
27 0.41
28 0.44
29 0.42
30 0.42
31 0.44
32 0.46
33 0.52
34 0.51
35 0.5
36 0.5
37 0.52
38 0.57
39 0.54
40 0.54
41 0.49
42 0.44
43 0.39
44 0.34
45 0.32
46 0.27
47 0.26
48 0.25
49 0.25
50 0.26
51 0.28
52 0.28
53 0.26
54 0.22
55 0.23
56 0.24
57 0.23
58 0.27
59 0.28
60 0.32
61 0.36
62 0.39
63 0.37
64 0.37
65 0.37
66 0.31
67 0.3
68 0.33
69 0.3
70 0.29
71 0.29
72 0.28
73 0.26
74 0.25
75 0.19
76 0.09
77 0.08
78 0.06
79 0.06
80 0.08
81 0.11
82 0.16
83 0.18
84 0.22
85 0.25
86 0.32
87 0.34
88 0.37
89 0.35
90 0.31
91 0.29
92 0.28
93 0.26
94 0.19
95 0.16
96 0.12
97 0.1
98 0.09
99 0.09
100 0.13
101 0.13
102 0.14
103 0.14
104 0.14
105 0.14
106 0.15
107 0.15
108 0.14
109 0.13
110 0.13
111 0.14
112 0.14
113 0.13
114 0.12
115 0.11
116 0.07
117 0.06
118 0.05
119 0.03
120 0.02
121 0.02
122 0.02
123 0.02
124 0.02
125 0.02
126 0.02
127 0.02
128 0.02
129 0.02
130 0.02
131 0.02
132 0.02
133 0.02
134 0.02
135 0.02
136 0.02
137 0.02
138 0.02
139 0.03
140 0.03
141 0.04
142 0.04
143 0.04
144 0.04
145 0.04
146 0.04
147 0.04
148 0.04
149 0.04
150 0.04
151 0.05
152 0.06
153 0.07
154 0.12
155 0.13
156 0.18
157 0.25
158 0.3
159 0.37
160 0.44
161 0.49
162 0.53
163 0.62
164 0.68
165 0.71
166 0.77
167 0.78
168 0.81
169 0.86
170 0.88
171 0.88
172 0.89
173 0.91
174 0.9
175 0.86
176 0.77
177 0.75
178 0.67
179 0.59
180 0.48
181 0.38
182 0.27
183 0.22
184 0.2
185 0.12
186 0.08
187 0.04
188 0.04
189 0.03
190 0.03
191 0.03
192 0.04
193 0.04
194 0.04
195 0.06
196 0.06
197 0.07
198 0.08
199 0.11
200 0.12
201 0.12
202 0.12
203 0.12
204 0.12
205 0.12
206 0.13
207 0.11
208 0.18
209 0.19
210 0.19
211 0.24
212 0.26
213 0.27
214 0.32
215 0.33
216 0.29
217 0.36
218 0.41
219 0.45
220 0.48
221 0.47
222 0.4
223 0.4
224 0.38
225 0.32
226 0.27
227 0.18
228 0.12
229 0.13
230 0.12
231 0.1
232 0.09
233 0.07
234 0.07
235 0.07
236 0.08
237 0.1
238 0.11
239 0.11
240 0.11
241 0.12
242 0.12
243 0.13
244 0.14
245 0.14
246 0.15
247 0.16
248 0.18
249 0.19
250 0.22
251 0.29
252 0.27
253 0.26
254 0.26
255 0.25
256 0.25
257 0.24
258 0.21
259 0.16
260 0.15
261 0.14
262 0.13
263 0.12
264 0.11
265 0.09
266 0.1
267 0.08
268 0.08
269 0.1
270 0.12
271 0.13
272 0.14
273 0.17
274 0.21
275 0.26
276 0.28
277 0.27
278 0.26
279 0.26
280 0.25
281 0.22
282 0.16
283 0.13
284 0.1
285 0.08
286 0.07
287 0.06
288 0.05
289 0.05
290 0.05
291 0.03
292 0.03
293 0.03
294 0.03
295 0.03
296 0.03
297 0.04
298 0.04
299 0.05
300 0.05
301 0.05
302 0.06
303 0.06
304 0.06
305 0.06
306 0.07
307 0.08
308 0.11
309 0.13
310 0.16
311 0.17
312 0.23
313 0.32
314 0.4
315 0.43
316 0.45
317 0.46
318 0.49
319 0.55
320 0.52
321 0.45
322 0.42
323 0.39
324 0.37
325 0.4
326 0.37
327 0.31
328 0.28
329 0.26
330 0.21
331 0.2
332 0.17
333 0.11