Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4TR56

Protein Details
Accession A0A4Q4TR56    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
133-159RTPEREPPPQQCRQRQQPEGARKQRKEHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 11.5, cyto_nucl 9.5, mito 7, nucl 6.5
Family & Domain DBs
Amino Acid Sequences MHLGGGPPYLIPPDGRRGDGAGGERPEGAHQQAAMAHLGIAGVEDAEQEEAHSSSQPGGEGEQGGRAPLGGVSVAGAVAVTTEAAARVVHGVHGADEAGSGRGRAGYERRLETVRRDVADERHVRVRLSRVPRTPEREPPPQQCRQRQQPEGARKQRKEPEAALREEGGWEEEVSARRVPGACHLDRGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.27
3 0.27
4 0.27
5 0.28
6 0.3
7 0.29
8 0.27
9 0.25
10 0.25
11 0.24
12 0.22
13 0.23
14 0.21
15 0.19
16 0.15
17 0.13
18 0.13
19 0.14
20 0.15
21 0.14
22 0.11
23 0.09
24 0.08
25 0.08
26 0.06
27 0.05
28 0.04
29 0.03
30 0.03
31 0.03
32 0.03
33 0.04
34 0.04
35 0.04
36 0.06
37 0.06
38 0.07
39 0.07
40 0.07
41 0.08
42 0.08
43 0.09
44 0.08
45 0.08
46 0.08
47 0.09
48 0.08
49 0.1
50 0.09
51 0.09
52 0.08
53 0.07
54 0.06
55 0.06
56 0.06
57 0.03
58 0.03
59 0.03
60 0.03
61 0.03
62 0.03
63 0.03
64 0.02
65 0.02
66 0.02
67 0.02
68 0.02
69 0.02
70 0.02
71 0.03
72 0.03
73 0.03
74 0.04
75 0.04
76 0.04
77 0.04
78 0.04
79 0.04
80 0.04
81 0.04
82 0.04
83 0.04
84 0.04
85 0.04
86 0.04
87 0.04
88 0.04
89 0.05
90 0.05
91 0.07
92 0.1
93 0.14
94 0.18
95 0.19
96 0.21
97 0.23
98 0.25
99 0.27
100 0.32
101 0.3
102 0.27
103 0.28
104 0.28
105 0.29
106 0.36
107 0.35
108 0.3
109 0.33
110 0.34
111 0.31
112 0.32
113 0.34
114 0.34
115 0.39
116 0.43
117 0.43
118 0.49
119 0.56
120 0.61
121 0.61
122 0.62
123 0.61
124 0.63
125 0.65
126 0.68
127 0.69
128 0.71
129 0.75
130 0.75
131 0.78
132 0.79
133 0.81
134 0.77
135 0.78
136 0.79
137 0.81
138 0.82
139 0.83
140 0.83
141 0.76
142 0.8
143 0.79
144 0.74
145 0.69
146 0.65
147 0.65
148 0.61
149 0.62
150 0.55
151 0.47
152 0.43
153 0.37
154 0.31
155 0.22
156 0.16
157 0.13
158 0.11
159 0.14
160 0.15
161 0.18
162 0.18
163 0.16
164 0.18
165 0.19
166 0.19
167 0.25
168 0.31
169 0.3