Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q4SSC4

Protein Details
Accession A0A4Q4SSC4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MDEKRPKRYRARRRHRWVAVLFIBasic
NLS Segment(s)
PositionSequence
4-16KRPKRYRARRRHR
Subcellular Location(s) plas 6, extr 5, golg 5, E.R. 4, cyto 3, mito 2, cyto_nucl 2, cyto_pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR004911  Interferon-induced_GILT  
Gene Ontology GO:0016671  F:oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor  
Pfam View protein in Pfam  
PF03227  GILT  
Amino Acid Sequences MDEKRPKRYRARRRHRWVAVLFIVTIPLYMLFSSRAGSSYAGRFLPVSSSQAPSSSSLSATTTSAENPPVPLEIHIMSKCPDARDCLNDLVLPAMVRVNEKVNFTLSYIGTPTENDGIECKHGPKECMGNIIELCAVHLYPDVKVHLGFTHCLTQDYEDIPDSELVEECALEYGMSIGDLNDCASRDNGAFGLSLLRESVKRSADVCLSTPKVLQAATFY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.95
2 0.92
3 0.9
4 0.82
5 0.79
6 0.72
7 0.62
8 0.52
9 0.41
10 0.34
11 0.23
12 0.2
13 0.12
14 0.07
15 0.06
16 0.06
17 0.07
18 0.07
19 0.08
20 0.09
21 0.09
22 0.1
23 0.1
24 0.12
25 0.14
26 0.15
27 0.18
28 0.17
29 0.17
30 0.17
31 0.16
32 0.18
33 0.17
34 0.18
35 0.17
36 0.2
37 0.2
38 0.21
39 0.22
40 0.2
41 0.21
42 0.17
43 0.15
44 0.13
45 0.14
46 0.14
47 0.13
48 0.12
49 0.1
50 0.11
51 0.12
52 0.13
53 0.12
54 0.11
55 0.12
56 0.12
57 0.11
58 0.11
59 0.12
60 0.11
61 0.15
62 0.14
63 0.15
64 0.15
65 0.17
66 0.18
67 0.17
68 0.17
69 0.17
70 0.2
71 0.22
72 0.24
73 0.22
74 0.21
75 0.19
76 0.18
77 0.15
78 0.13
79 0.09
80 0.06
81 0.06
82 0.06
83 0.06
84 0.07
85 0.1
86 0.11
87 0.12
88 0.13
89 0.14
90 0.14
91 0.14
92 0.16
93 0.12
94 0.11
95 0.1
96 0.1
97 0.09
98 0.08
99 0.09
100 0.08
101 0.07
102 0.07
103 0.08
104 0.08
105 0.1
106 0.1
107 0.11
108 0.13
109 0.14
110 0.15
111 0.16
112 0.2
113 0.19
114 0.23
115 0.22
116 0.2
117 0.19
118 0.19
119 0.17
120 0.12
121 0.11
122 0.07
123 0.07
124 0.05
125 0.07
126 0.06
127 0.06
128 0.08
129 0.09
130 0.09
131 0.1
132 0.1
133 0.11
134 0.12
135 0.12
136 0.13
137 0.17
138 0.16
139 0.18
140 0.18
141 0.17
142 0.18
143 0.18
144 0.18
145 0.13
146 0.14
147 0.13
148 0.13
149 0.12
150 0.1
151 0.09
152 0.09
153 0.08
154 0.07
155 0.06
156 0.06
157 0.06
158 0.05
159 0.05
160 0.04
161 0.04
162 0.04
163 0.04
164 0.04
165 0.05
166 0.05
167 0.06
168 0.07
169 0.08
170 0.09
171 0.09
172 0.11
173 0.11
174 0.12
175 0.11
176 0.1
177 0.1
178 0.09
179 0.12
180 0.1
181 0.1
182 0.09
183 0.11
184 0.11
185 0.15
186 0.2
187 0.2
188 0.22
189 0.22
190 0.26
191 0.29
192 0.31
193 0.3
194 0.33
195 0.34
196 0.33
197 0.33
198 0.3
199 0.28
200 0.25