Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4STR3

Protein Details
Accession A0A4Q4STR3    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
10-38DNLKAKLKAIFKKKSKKDKKDEPPKAAETBasic
NLS Segment(s)
PositionSequence
13-33KAKLKAIFKKKSKKDKKDEPP
Subcellular Location(s) mito 15, nucl 8.5, cyto_nucl 6.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR005819  H1/H5  
Gene Ontology GO:0000786  C:nucleosome  
GO:0003677  F:DNA binding  
GO:0030527  F:structural constituent of chromatin  
GO:0006334  P:nucleosome assembly  
Amino Acid Sequences MPGVPIGALDNLKAKLKAIFKKKSKKDKKDEPPKAAETSTAPADAPEEGTQPKEASAAAPADATKPEEVKSEAPATTEPTQAEPAAPAAAPSTAPAAVEPAPALPAPALSENKEEPKPAGAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.22
3 0.29
4 0.37
5 0.43
6 0.51
7 0.58
8 0.69
9 0.78
10 0.83
11 0.87
12 0.89
13 0.9
14 0.91
15 0.92
16 0.93
17 0.93
18 0.9
19 0.85
20 0.79
21 0.71
22 0.6
23 0.5
24 0.41
25 0.34
26 0.27
27 0.2
28 0.16
29 0.12
30 0.13
31 0.11
32 0.11
33 0.08
34 0.09
35 0.09
36 0.1
37 0.11
38 0.1
39 0.1
40 0.08
41 0.08
42 0.07
43 0.08
44 0.07
45 0.07
46 0.07
47 0.07
48 0.07
49 0.07
50 0.08
51 0.07
52 0.07
53 0.08
54 0.09
55 0.11
56 0.12
57 0.14
58 0.15
59 0.15
60 0.15
61 0.15
62 0.19
63 0.18
64 0.19
65 0.17
66 0.16
67 0.18
68 0.17
69 0.17
70 0.12
71 0.11
72 0.1
73 0.09
74 0.07
75 0.06
76 0.07
77 0.06
78 0.06
79 0.07
80 0.07
81 0.07
82 0.07
83 0.09
84 0.09
85 0.1
86 0.09
87 0.08
88 0.09
89 0.09
90 0.09
91 0.07
92 0.07
93 0.09
94 0.13
95 0.16
96 0.17
97 0.21
98 0.25
99 0.31
100 0.32
101 0.32
102 0.29