Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4SUZ3

Protein Details
Accession A0A4Q4SUZ3    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
92-114VDVAVRPRRPPRRGRVVRDAPLLHydrophilic
NLS Segment(s)
PositionSequence
98-105PRRPPRRG
Subcellular Location(s) mito 10, cyto 9.5, cyto_nucl 7, extr 4, nucl 3.5
Family & Domain DBs
Amino Acid Sequences MPAPYNRTPAVFQTLSEHLFPDASQGLGPRLVHHLVVEPGVLPLRRLRGPAQRLDPGGADDLVPPDGALDVSVRLRVLVLPLAAEGVDARLVDVAVRPRRPPRRGRVVRDAPLLLRLQGLDLGRRDVLVASG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.3
3 0.28
4 0.25
5 0.18
6 0.18
7 0.17
8 0.15
9 0.12
10 0.11
11 0.11
12 0.11
13 0.12
14 0.14
15 0.14
16 0.12
17 0.15
18 0.16
19 0.15
20 0.15
21 0.16
22 0.14
23 0.14
24 0.13
25 0.09
26 0.09
27 0.11
28 0.1
29 0.09
30 0.1
31 0.14
32 0.15
33 0.17
34 0.21
35 0.28
36 0.32
37 0.37
38 0.4
39 0.39
40 0.39
41 0.37
42 0.33
43 0.25
44 0.22
45 0.16
46 0.11
47 0.08
48 0.08
49 0.07
50 0.07
51 0.05
52 0.04
53 0.04
54 0.04
55 0.04
56 0.03
57 0.04
58 0.04
59 0.05
60 0.05
61 0.05
62 0.05
63 0.05
64 0.06
65 0.06
66 0.05
67 0.05
68 0.05
69 0.05
70 0.05
71 0.05
72 0.04
73 0.03
74 0.04
75 0.04
76 0.04
77 0.04
78 0.04
79 0.04
80 0.07
81 0.14
82 0.2
83 0.22
84 0.26
85 0.36
86 0.46
87 0.53
88 0.61
89 0.63
90 0.68
91 0.76
92 0.81
93 0.82
94 0.82
95 0.8
96 0.76
97 0.68
98 0.57
99 0.52
100 0.44
101 0.34
102 0.25
103 0.19
104 0.15
105 0.16
106 0.16
107 0.17
108 0.18
109 0.2
110 0.2
111 0.2
112 0.19