Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4SVN8

Protein Details
Accession A0A4Q4SVN8   
Localization Confidence Low
Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
52-76DGNALRRTPRKPKKPRRTGFGRGSHBasic
NLS Segment(s)
PositionSequence
57-70RRTPRKPKKPRRTG
Subcellular Location(s) cyto 10cysk 10, nucl 3, extr 3
Family & Domain DBs
Amino Acid Sequences MIAFEIIKILISLQACRDEIDLYELGWEQIYARVKAAFSGGGYPEYEPYGEDGNALRRTPRKPKKPRRTGFGRGSHESAPYGFVIGKENDTAYGFVVGGEGDTAYSFGTGGEGDSPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.17
4 0.18
5 0.15
6 0.15
7 0.18
8 0.16
9 0.12
10 0.13
11 0.12
12 0.11
13 0.11
14 0.1
15 0.06
16 0.11
17 0.14
18 0.13
19 0.14
20 0.15
21 0.15
22 0.15
23 0.16
24 0.12
25 0.09
26 0.1
27 0.1
28 0.1
29 0.1
30 0.1
31 0.1
32 0.1
33 0.09
34 0.07
35 0.08
36 0.09
37 0.08
38 0.08
39 0.09
40 0.13
41 0.15
42 0.15
43 0.16
44 0.18
45 0.23
46 0.34
47 0.43
48 0.48
49 0.58
50 0.7
51 0.79
52 0.86
53 0.88
54 0.85
55 0.85
56 0.83
57 0.81
58 0.79
59 0.74
60 0.66
61 0.64
62 0.56
63 0.47
64 0.39
65 0.29
66 0.21
67 0.15
68 0.12
69 0.09
70 0.09
71 0.11
72 0.12
73 0.13
74 0.12
75 0.12
76 0.12
77 0.13
78 0.13
79 0.1
80 0.1
81 0.09
82 0.08
83 0.08
84 0.07
85 0.06
86 0.05
87 0.04
88 0.04
89 0.04
90 0.04
91 0.04
92 0.04
93 0.04
94 0.04
95 0.05
96 0.05
97 0.05