Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4STF7

Protein Details
Accession A0A4Q4STF7    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MARRRRFRHMEKARRKKKYRRVAAAVGABasic
NLS Segment(s)
PositionSequence
3-23RRRRFRHMEKARRKKKYRRVA
54-61GGRHKKRK
Subcellular Location(s) nucl 12mito 12mito_nucl 12
Family & Domain DBs
Amino Acid Sequences MARRRRFRHMEKARRKKKYRRVAAAVGADGEGGEGGEGGKGGEGGSGGGGQYSGGRHKKRKTAVPGPGGGDENDNRVDIETRLRKLLGQDAY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.93
3 0.93
4 0.92
5 0.92
6 0.91
7 0.9
8 0.87
9 0.83
10 0.8
11 0.72
12 0.61
13 0.51
14 0.39
15 0.29
16 0.21
17 0.14
18 0.07
19 0.03
20 0.03
21 0.02
22 0.02
23 0.02
24 0.02
25 0.02
26 0.02
27 0.03
28 0.03
29 0.03
30 0.03
31 0.03
32 0.03
33 0.03
34 0.03
35 0.03
36 0.03
37 0.03
38 0.03
39 0.04
40 0.1
41 0.17
42 0.22
43 0.3
44 0.35
45 0.43
46 0.49
47 0.57
48 0.61
49 0.64
50 0.67
51 0.66
52 0.64
53 0.59
54 0.55
55 0.47
56 0.38
57 0.32
58 0.24
59 0.21
60 0.18
61 0.16
62 0.14
63 0.14
64 0.16
65 0.13
66 0.22
67 0.27
68 0.28
69 0.3
70 0.31
71 0.31
72 0.33