Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4V1XBK6

Protein Details
Accession A0A4V1XBK6    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MATQQQTPKPAKKTKKTLRAALPNRGYHydrophilic
NLS Segment(s)
PositionSequence
13-13K
Subcellular Location(s) nucl 19, mito 4, cyto 4, cyto_mito 4
Family & Domain DBs
Amino Acid Sequences MATQQQTPKPAKKTKKTLRAALPNRGYEFKDGRSVFESVDDGTVFKAALHKVARNLHRNEVDKVLADLTMKAKEVRKPRATDHSGAFEEARKQTPWASELKEGIISELLLGLVSARALHIKFMRFRPNTVDPRTEGPLAKGIDAFTGEQPAAEPEEHYKMYELDPKLIDNMMERMRKGLVADWDAYSNYNPSDEEMEGAGEEKGGEQKDLGDTLKGLSLN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.87
3 0.87
4 0.87
5 0.87
6 0.88
7 0.85
8 0.84
9 0.8
10 0.74
11 0.7
12 0.63
13 0.55
14 0.5
15 0.47
16 0.39
17 0.41
18 0.36
19 0.36
20 0.35
21 0.34
22 0.28
23 0.26
24 0.24
25 0.16
26 0.17
27 0.14
28 0.11
29 0.1
30 0.1
31 0.08
32 0.07
33 0.1
34 0.09
35 0.15
36 0.17
37 0.19
38 0.25
39 0.33
40 0.4
41 0.45
42 0.48
43 0.5
44 0.55
45 0.56
46 0.52
47 0.48
48 0.41
49 0.34
50 0.31
51 0.24
52 0.17
53 0.14
54 0.13
55 0.11
56 0.12
57 0.12
58 0.14
59 0.17
60 0.22
61 0.3
62 0.39
63 0.43
64 0.45
65 0.49
66 0.56
67 0.57
68 0.55
69 0.49
70 0.45
71 0.39
72 0.37
73 0.32
74 0.24
75 0.23
76 0.22
77 0.21
78 0.16
79 0.16
80 0.17
81 0.18
82 0.18
83 0.18
84 0.19
85 0.19
86 0.19
87 0.19
88 0.18
89 0.16
90 0.15
91 0.11
92 0.08
93 0.06
94 0.05
95 0.05
96 0.03
97 0.03
98 0.03
99 0.02
100 0.02
101 0.02
102 0.02
103 0.04
104 0.04
105 0.06
106 0.09
107 0.12
108 0.16
109 0.2
110 0.3
111 0.29
112 0.31
113 0.36
114 0.43
115 0.47
116 0.47
117 0.46
118 0.38
119 0.41
120 0.42
121 0.37
122 0.29
123 0.23
124 0.24
125 0.22
126 0.21
127 0.18
128 0.15
129 0.13
130 0.14
131 0.14
132 0.08
133 0.09
134 0.09
135 0.08
136 0.08
137 0.08
138 0.09
139 0.08
140 0.09
141 0.1
142 0.14
143 0.15
144 0.15
145 0.15
146 0.14
147 0.17
148 0.23
149 0.21
150 0.21
151 0.22
152 0.22
153 0.22
154 0.21
155 0.19
156 0.14
157 0.18
158 0.21
159 0.22
160 0.22
161 0.22
162 0.23
163 0.23
164 0.22
165 0.21
166 0.2
167 0.21
168 0.22
169 0.22
170 0.22
171 0.22
172 0.22
173 0.19
174 0.16
175 0.13
176 0.12
177 0.12
178 0.12
179 0.15
180 0.14
181 0.15
182 0.13
183 0.13
184 0.12
185 0.13
186 0.11
187 0.07
188 0.07
189 0.07
190 0.11
191 0.11
192 0.12
193 0.11
194 0.13
195 0.15
196 0.18
197 0.18
198 0.15
199 0.15
200 0.15