Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4TTX4

Protein Details
Accession A0A4Q4TTX4    Localization Confidence Low Confidence Score 5.5
NoLS Segment(s)
PositionSequenceProtein Nature
104-123ALCFLCSRRRKKGNSRSESPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, cyto 6.5, extr 5, cyto_nucl 4.5, nucl 1.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR008160  Collagen  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF01391  Collagen  
Amino Acid Sequences MSTSRNKTSVRSLYPPPPTVMLEARRPRIVTLTVTRPSVTSIAVISLGNGNAGDTAPTRDVMDNAVSTTTPSPAPAPGSANKGVSETAVAIIGVTLGLTCVLLALCFLCSRRRKKGNSRSESPYYGPYPYKPPRGLRGPPGPPGEAGPPGSRGEQGSQGLPGAPGIAGSAGPSGQPGPSGPQGLPGVPGREGPQGLQGIPGRQGDPGTAGRDGRDGRDGADGRYGRDGADGKDGVDGRDREMGSAGLLEKLDPRVKPDRLGKTDRQVKLVHPGRLGLREKLGRRANAALAVGVAIRALGATKVPGDRRALVVPWEIVGATAAIAM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.64
3 0.57
4 0.51
5 0.45
6 0.44
7 0.44
8 0.4
9 0.42
10 0.47
11 0.5
12 0.5
13 0.49
14 0.46
15 0.44
16 0.41
17 0.38
18 0.37
19 0.4
20 0.4
21 0.41
22 0.4
23 0.35
24 0.35
25 0.29
26 0.23
27 0.15
28 0.12
29 0.12
30 0.12
31 0.12
32 0.1
33 0.11
34 0.1
35 0.09
36 0.09
37 0.08
38 0.07
39 0.07
40 0.08
41 0.07
42 0.1
43 0.1
44 0.11
45 0.13
46 0.13
47 0.14
48 0.15
49 0.16
50 0.13
51 0.13
52 0.13
53 0.11
54 0.12
55 0.12
56 0.12
57 0.1
58 0.1
59 0.11
60 0.12
61 0.14
62 0.15
63 0.18
64 0.19
65 0.25
66 0.26
67 0.26
68 0.24
69 0.23
70 0.21
71 0.17
72 0.15
73 0.1
74 0.08
75 0.07
76 0.07
77 0.05
78 0.05
79 0.05
80 0.04
81 0.03
82 0.02
83 0.02
84 0.02
85 0.02
86 0.02
87 0.03
88 0.03
89 0.03
90 0.03
91 0.03
92 0.04
93 0.05
94 0.06
95 0.14
96 0.22
97 0.29
98 0.39
99 0.47
100 0.56
101 0.66
102 0.76
103 0.8
104 0.8
105 0.8
106 0.77
107 0.73
108 0.68
109 0.58
110 0.52
111 0.42
112 0.37
113 0.32
114 0.27
115 0.31
116 0.33
117 0.39
118 0.39
119 0.41
120 0.44
121 0.51
122 0.52
123 0.51
124 0.54
125 0.5
126 0.51
127 0.51
128 0.44
129 0.37
130 0.35
131 0.29
132 0.21
133 0.19
134 0.14
135 0.14
136 0.14
137 0.14
138 0.14
139 0.13
140 0.12
141 0.14
142 0.14
143 0.12
144 0.11
145 0.11
146 0.1
147 0.09
148 0.08
149 0.05
150 0.04
151 0.03
152 0.03
153 0.03
154 0.03
155 0.03
156 0.03
157 0.03
158 0.03
159 0.04
160 0.04
161 0.04
162 0.04
163 0.04
164 0.07
165 0.09
166 0.1
167 0.1
168 0.14
169 0.14
170 0.14
171 0.16
172 0.14
173 0.14
174 0.13
175 0.14
176 0.12
177 0.14
178 0.14
179 0.12
180 0.15
181 0.14
182 0.14
183 0.17
184 0.16
185 0.15
186 0.17
187 0.18
188 0.14
189 0.14
190 0.14
191 0.11
192 0.13
193 0.14
194 0.14
195 0.14
196 0.14
197 0.14
198 0.18
199 0.18
200 0.16
201 0.17
202 0.15
203 0.15
204 0.22
205 0.22
206 0.19
207 0.26
208 0.25
209 0.23
210 0.25
211 0.24
212 0.17
213 0.19
214 0.2
215 0.14
216 0.19
217 0.18
218 0.16
219 0.2
220 0.2
221 0.18
222 0.22
223 0.21
224 0.18
225 0.24
226 0.23
227 0.2
228 0.2
229 0.2
230 0.14
231 0.15
232 0.13
233 0.09
234 0.09
235 0.09
236 0.1
237 0.14
238 0.18
239 0.16
240 0.22
241 0.29
242 0.31
243 0.38
244 0.45
245 0.51
246 0.55
247 0.62
248 0.62
249 0.65
250 0.72
251 0.67
252 0.63
253 0.54
254 0.49
255 0.52
256 0.54
257 0.48
258 0.39
259 0.4
260 0.39
261 0.46
262 0.47
263 0.39
264 0.39
265 0.42
266 0.43
267 0.5
268 0.53
269 0.47
270 0.47
271 0.48
272 0.43
273 0.4
274 0.37
275 0.28
276 0.21
277 0.19
278 0.15
279 0.11
280 0.08
281 0.04
282 0.04
283 0.03
284 0.04
285 0.04
286 0.05
287 0.06
288 0.09
289 0.15
290 0.18
291 0.23
292 0.27
293 0.28
294 0.32
295 0.34
296 0.33
297 0.31
298 0.32
299 0.28
300 0.24
301 0.23
302 0.18
303 0.15
304 0.14
305 0.1