Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4V1X9W3

Protein Details
Accession A0A4V1X9W3    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
77-98FAKARAGKKRRSGRASHSRSRMBasic
NLS Segment(s)
PositionSequence
79-98KARAGKKRRSGRASHSRSRM
Subcellular Location(s) nucl 15.5, cyto_nucl 11, mito 6, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MRTSAGINYNIYNDEAGTKYVIPGLPMPKFGSGSGSDKTRLSAMLLAEPTATEPDATETTATESATPGSTNPSSPTFAKARAGKKRRSGRASHSRSRMH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.13
4 0.12
5 0.11
6 0.11
7 0.13
8 0.13
9 0.12
10 0.15
11 0.19
12 0.19
13 0.21
14 0.22
15 0.21
16 0.22
17 0.2
18 0.19
19 0.17
20 0.19
21 0.19
22 0.2
23 0.2
24 0.19
25 0.19
26 0.17
27 0.14
28 0.12
29 0.12
30 0.11
31 0.12
32 0.12
33 0.11
34 0.1
35 0.1
36 0.09
37 0.07
38 0.07
39 0.04
40 0.04
41 0.06
42 0.07
43 0.07
44 0.07
45 0.07
46 0.09
47 0.1
48 0.1
49 0.08
50 0.08
51 0.08
52 0.09
53 0.09
54 0.07
55 0.11
56 0.11
57 0.12
58 0.14
59 0.16
60 0.19
61 0.2
62 0.24
63 0.22
64 0.24
65 0.3
66 0.35
67 0.42
68 0.5
69 0.57
70 0.61
71 0.68
72 0.76
73 0.79
74 0.8
75 0.78
76 0.77
77 0.81
78 0.81
79 0.81