Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G9MME1

Protein Details
Accession G9MME1    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
54-74EKKHHALKYPGYRYKPNRRPKBasic
NLS Segment(s)
PositionSequence
68-74KPNRRPK
Subcellular Location(s) nucl 21, mito_nucl 13.833, cyto_nucl 11.333, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01389  HMG-box_ROX1-like  
Amino Acid Sequences PITGFMLYRQHHQSSVAKDNKGSSNPEISKIIGNMWKRLTEHEREIWTQLAEEEKKHHALKYPGYRYKPNRRPK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.47
3 0.47
4 0.43
5 0.42
6 0.45
7 0.45
8 0.42
9 0.38
10 0.31
11 0.34
12 0.33
13 0.35
14 0.32
15 0.29
16 0.27
17 0.23
18 0.23
19 0.19
20 0.19
21 0.19
22 0.19
23 0.2
24 0.19
25 0.23
26 0.25
27 0.24
28 0.27
29 0.29
30 0.31
31 0.3
32 0.31
33 0.28
34 0.24
35 0.2
36 0.17
37 0.18
38 0.16
39 0.16
40 0.18
41 0.2
42 0.26
43 0.27
44 0.28
45 0.29
46 0.34
47 0.42
48 0.49
49 0.56
50 0.59
51 0.64
52 0.72
53 0.75
54 0.81