Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4SZM1

Protein Details
Accession A0A4Q4SZM1    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
240-267LHNAEGKDTTKKKRRKKMTKATTKMSGAHydrophilic
NLS Segment(s)
PositionSequence
227-260KDRERRSRRGRGSLHNAEGKDTTKKKRRKKMTKA
Subcellular Location(s) nucl 17, cyto 5, mito 4
Family & Domain DBs
Amino Acid Sequences MDLYQHNSMKVAKLRSQSDLSRLHSYQYHHGEHDHGHDHGRKGHLRRSQSLDSASLQLKRHHQTLEVLQDTWATSSYHLSRSALRCTKTRQHAEIRAFVNAMQAYDQVLQDIRFAFPCTFLPAAGMHRRHKTTTALPSTLPPHHHPMVIASLQSAFAAVAHASWRIEKYVSLGDVSARCLERTHVGRGGISGPAGVLEREITFLSAFLAQLGGADDEMDGYGDEGGKDRERRSRRGRGSLHNAEGKDTTKKKRRKKMTKATTKMSGALRQSKGTWRTHLRMPFESGMVRAGPESPLLLDLAYQCFKLLDALHPASTPKTARWMLDNVLAGRPGEPSGRALLRHKVETMALLRSRDRMCVTEHDSGT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.5
3 0.54
4 0.5
5 0.52
6 0.53
7 0.52
8 0.52
9 0.49
10 0.46
11 0.44
12 0.45
13 0.47
14 0.47
15 0.45
16 0.39
17 0.4
18 0.4
19 0.39
20 0.4
21 0.34
22 0.28
23 0.3
24 0.34
25 0.36
26 0.38
27 0.43
28 0.44
29 0.46
30 0.53
31 0.54
32 0.56
33 0.59
34 0.62
35 0.6
36 0.58
37 0.55
38 0.5
39 0.45
40 0.43
41 0.39
42 0.36
43 0.34
44 0.34
45 0.4
46 0.41
47 0.43
48 0.39
49 0.38
50 0.38
51 0.42
52 0.46
53 0.4
54 0.37
55 0.33
56 0.32
57 0.3
58 0.25
59 0.19
60 0.11
61 0.09
62 0.14
63 0.16
64 0.18
65 0.19
66 0.2
67 0.26
68 0.29
69 0.38
70 0.39
71 0.39
72 0.41
73 0.47
74 0.55
75 0.58
76 0.62
77 0.59
78 0.62
79 0.68
80 0.68
81 0.67
82 0.6
83 0.51
84 0.44
85 0.37
86 0.32
87 0.24
88 0.19
89 0.13
90 0.11
91 0.12
92 0.13
93 0.13
94 0.09
95 0.1
96 0.1
97 0.11
98 0.11
99 0.1
100 0.09
101 0.12
102 0.11
103 0.12
104 0.12
105 0.15
106 0.14
107 0.13
108 0.13
109 0.13
110 0.18
111 0.23
112 0.28
113 0.29
114 0.34
115 0.37
116 0.37
117 0.39
118 0.38
119 0.38
120 0.42
121 0.43
122 0.39
123 0.37
124 0.38
125 0.4
126 0.38
127 0.35
128 0.28
129 0.29
130 0.29
131 0.29
132 0.26
133 0.23
134 0.24
135 0.21
136 0.18
137 0.12
138 0.11
139 0.11
140 0.1
141 0.09
142 0.05
143 0.04
144 0.04
145 0.04
146 0.04
147 0.04
148 0.05
149 0.05
150 0.06
151 0.07
152 0.07
153 0.07
154 0.07
155 0.09
156 0.1
157 0.11
158 0.1
159 0.1
160 0.11
161 0.11
162 0.12
163 0.12
164 0.1
165 0.1
166 0.1
167 0.11
168 0.14
169 0.17
170 0.19
171 0.19
172 0.19
173 0.18
174 0.19
175 0.19
176 0.14
177 0.11
178 0.08
179 0.05
180 0.05
181 0.06
182 0.05
183 0.04
184 0.04
185 0.04
186 0.06
187 0.06
188 0.06
189 0.05
190 0.06
191 0.06
192 0.06
193 0.06
194 0.05
195 0.05
196 0.04
197 0.04
198 0.05
199 0.04
200 0.03
201 0.04
202 0.04
203 0.04
204 0.04
205 0.04
206 0.03
207 0.03
208 0.03
209 0.03
210 0.04
211 0.05
212 0.07
213 0.1
214 0.13
215 0.15
216 0.24
217 0.29
218 0.39
219 0.47
220 0.56
221 0.6
222 0.67
223 0.71
224 0.71
225 0.76
226 0.74
227 0.7
228 0.64
229 0.57
230 0.49
231 0.44
232 0.37
233 0.35
234 0.35
235 0.39
236 0.44
237 0.54
238 0.62
239 0.71
240 0.8
241 0.83
242 0.88
243 0.9
244 0.92
245 0.93
246 0.91
247 0.86
248 0.82
249 0.72
250 0.66
251 0.58
252 0.52
253 0.46
254 0.48
255 0.43
256 0.38
257 0.38
258 0.41
259 0.44
260 0.42
261 0.44
262 0.43
263 0.45
264 0.5
265 0.55
266 0.52
267 0.49
268 0.51
269 0.45
270 0.4
271 0.36
272 0.3
273 0.25
274 0.2
275 0.17
276 0.12
277 0.11
278 0.1
279 0.09
280 0.09
281 0.08
282 0.08
283 0.08
284 0.07
285 0.07
286 0.08
287 0.12
288 0.13
289 0.12
290 0.12
291 0.12
292 0.12
293 0.14
294 0.13
295 0.13
296 0.2
297 0.22
298 0.22
299 0.23
300 0.24
301 0.23
302 0.26
303 0.24
304 0.18
305 0.25
306 0.26
307 0.27
308 0.31
309 0.33
310 0.31
311 0.35
312 0.38
313 0.31
314 0.31
315 0.3
316 0.26
317 0.22
318 0.21
319 0.17
320 0.15
321 0.14
322 0.14
323 0.19
324 0.21
325 0.24
326 0.27
327 0.35
328 0.38
329 0.4
330 0.39
331 0.35
332 0.33
333 0.35
334 0.34
335 0.33
336 0.32
337 0.32
338 0.33
339 0.38
340 0.38
341 0.38
342 0.38
343 0.32
344 0.32
345 0.38
346 0.43